[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68038.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:43 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->34 PF08365 * IGF2_C 0.00054 30.4 23/56  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68038.1 GT:GENE ACF68038.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2064826..2064957 GB:FROM 2064826 GB:TO 2064957 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF68038.1 GB:DB_XREF GI:194407819 LENGTH 43 SQ:AASEQ MQKGNTLFRKTTLPMTVSQRRCRRKMQGLGAGDEEALSPLAEA GT:EXON 1|1-43:0| HM:PFM:NREP 1 HM:PFM:REP 12->34|PF08365|0.00054|30.4|23/56|IGF2_C| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,26-29,41-44| PSIPRED ccccccHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHcc //