[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68054.1
DDBJ      :             transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  744/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:296 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->289 3fzvB PDBj 6e-18 25.6 %
:RPS:PDB   1->201 1bi3A PDBj 3e-30 7.7 %
:RPS:SCOP  1->101 1b9mA1  a.4.5.8 * 5e-19 15.8 %
:RPS:SCOP  91->293 1i69A  c.94.1.1 * 4e-35 22.3 %
:HMM:SCOP  1->89 1ixcA1 a.4.5.37 * 1.6e-20 36.0 %
:HMM:SCOP  82->290 1uthA_ c.94.1.1 * 6e-38 30.3 %
:RPS:PFM   3->61 PF00126 * HTH_1 2e-08 42.4 %
:RPS:PFM   91->287 PF03466 * LysR_substrate 3e-19 30.5 %
:HMM:PFM   87->288 PF03466 * LysR_substrate 8.2e-44 32.2 202/209  
:HMM:PFM   3->61 PF00126 * HTH_1 9.5e-20 47.5 59/60  
:BLT:SWISS 1->289 YWBI_BACSU 9e-38 29.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68054.1 GT:GENE ACF68054.1 GT:PRODUCT transcriptional regulator GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 874692..875582 GB:FROM 874692 GB:TO 875582 GB:DIRECTION + GB:PRODUCT transcriptional regulator GB:NOTE identified by match to protein family HMM PF00126; match to protein family HMM PF03466 GB:PROTEIN_ID ACF68054.1 GB:DB_XREF GI:194407835 LENGTH 296 SQ:AASEQ MEIRQLEYFVSASLLGNLTRVAERHFVSQPNITIAIKKLETELGMTLFDRKKNKLVLTEEGMFFLQKIEPILIALKNSVAEMKDYRNENGGIVTLGIPPMISLFLFSPLFKHFREIYPEMELSLVEEGTFGLHDKLSAGELDLAIVIINDCPKELVTVPLMTQQHVVCMSDKHPLAKKDSIDWEDLQYEPLILMKKDSWHRKTIIEECTKRGIHTHIFLSSNRIQTNIDLVAKNEGISFILDAVDLKAEKVITKAMTEPTYVTIGLAWKKDKYLSYATRALIKFIEDYIKEHFTIK GT:EXON 1|1-296:0| BL:SWS:NREP 1 BL:SWS:REP 1->289|YWBI_BACSU|9e-38|29.4|289/301| BL:PDB:NREP 1 BL:PDB:REP 3->289|3fzvB|6e-18|25.6|273/284| RP:PDB:NREP 1 RP:PDB:REP 1->201|1bi3A|3e-30|7.7|196/211| RP:PFM:NREP 2 RP:PFM:REP 3->61|PF00126|2e-08|42.4|59/60|HTH_1| RP:PFM:REP 91->287|PF03466|3e-19|30.5|197/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 87->288|PF03466|8.2e-44|32.2|202/209|LysR_substrate| HM:PFM:REP 3->61|PF00126|9.5e-20|47.5|59/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->101|1b9mA1|5e-19|15.8|101/122|a.4.5.8| RP:SCP:REP 91->293|1i69A|4e-35|22.3|197/206|c.94.1.1| HM:SCP:REP 1->89|1ixcA1|1.6e-20|36.0|89/0|a.4.5.37|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 82->290|1uthA_|6e-38|30.3|208/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 5896 OP:NHOMOORG 754 OP:PATTERN -----------------------------------------------------1-------------- 4661711244521174411-13222A11111255656EKH-4261--1-11-2221-2--243-25F6882-222-12-1575111112221-211---11811251214---------------1---1----1-34434---315335445342211111134378552111111111111121-----43FDDDDDCDD7CBDCEC95EBDFDBF243B421566655NX1222222122222227333845454552524EF666534622342334433333332222222222234344443444443223332225-64CD555556535428883223A31-165611JM5522116-2111--41226331-----45GEH4477C46877767576689-33542F6CDA4-KDDG8BCJLCLFJJ3225BC454759A8888888879842324------------------------------17C23HkYPZQZZadSGHGHFSSlcJJJICIjOwVeba-2LIB879CAXCR6UH7B85324D5333341333469B52212231138224-112535231432465131-2------------------111187C9A748A39997A9A946AFCC9ACE89AD1-135361-----JBGF6DBFFFDFDDCGE-GEEFGCCFFEGDGDDEEDBSXRGG69BICIEIIJHHHHEIEEFNAC9BBBC2-977788668888--161111157464489S334437366463554JJHIJAI366J5NNKNOWPVESSQN8IFM2221112223A9AF99999CDBCA7779A9A55532221-4222------------1-------------------------------------351 -------------3------------------------------------------------------------------------------------------------------------------------------------------------6------1----8--1-1---------1--6-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 99.7 SQ:SECSTR HHHHHHHHHHHHTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEccEEcTTccEEEcHHHHHHHHHHHHHHHHHHHHHHHTTcccHHccHHHHHHHHTTTccHHHHHHHHHHccEcccccTTccccTTHHHHTcccEEHHHHcccccEEEEEEEccGGGccccTHHHHHHHTTccTTcEEEEccccEEEETTEEEEccHHHEEEEGGGcTTccTTcEEEEcEEEEEEcGGGHTccEEEEGGccTTTcTTcEEEEccTTccEEEEEEEETTccccHHHHHHHHHHcTTccHHccc# DISOP:02AL 85-86,296-297| PSIPRED ccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEEccccccccEEEEEEEEccEEEEEcccccccccccccHHHHccccEEEEccccHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHccccEEEEEHHHHcccccEEEEEcccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHccc //