[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68058.1
DDBJ      :             small protein A
Swiss-Prot:SMPA_SHIFL   RecName: Full=Small protein A;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  204/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->80 2pxgA PDBj 9e-09 38.2 %
:RPS:PDB   20->101 3d4eA PDBj 3e-14 13.4 %
:RPS:PFM   36->103 PF04355 * SmpA_OmlA 7e-14 51.5 %
:HMM:PFM   35->104 PF04355 * SmpA_OmlA 1.5e-30 42.9 70/71  
:HMM:PFM   5->33 PF05584 * Sulfolobus_pRN 0.00081 31.0 29/72  
:BLT:SWISS 1->111 SMPA_SHIFL 1e-49 92.8 %
:PROS 31->43|PS00018|EF_HAND_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68058.1 GT:GENE ACF68058.1 GT:PRODUCT small protein A GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2833271..2833609 GB:FROM 2833271 GB:TO 2833609 GB:DIRECTION + GB:PRODUCT small protein A GB:NOTE identified by match to protein family HMM PF04355 GB:PROTEIN_ID ACF68058.1 GB:DB_XREF GI:194407839 LENGTH 112 SQ:AASEQ MRCKTLTAAAAVLLMLTAGCSTLERVVYRPDINQGNYLTPTDVAKVRVGMTQQQVAYALGTPMMTDPFGTNTWFYVFRQQPGHENVTQQTLTLTFNSSGVLTNIDNKPALTK GT:EXON 1|1-112:0| SW:ID SMPA_SHIFL SW:DE RecName: Full=Small protein A;Flags: Precursor; SW:GN Name=smpA; OrderedLocusNames=SF2676, S2854; SW:KW Cell membrane; Cell outer membrane; Complete proteome; Lipoprotein;Membrane; Palmitate; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->111|SMPA_SHIFL|1e-49|92.8|111/113| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009279|"GO:cell outer membrane"|Cell outer membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| PROS 31->43|PS00018|EF_HAND_1|PDOC00018| TM:NTM 1 TM:REGION 4->26| SEG 5->18|tltaaaavllmlta| BL:PDB:NREP 1 BL:PDB:REP 26->80|2pxgA|9e-09|38.2|55/118| RP:PDB:NREP 1 RP:PDB:REP 20->101|3d4eA|3e-14|13.4|82/160| RP:PFM:NREP 1 RP:PFM:REP 36->103|PF04355|7e-14|51.5|68/71|SmpA_OmlA| HM:PFM:NREP 2 HM:PFM:REP 35->104|PF04355|1.5e-30|42.9|70/71|SmpA_OmlA| HM:PFM:REP 5->33|PF05584|0.00081|31.0|29/72|Sulfolobus_pRN| GO:PFM:NREP 1 GO:PFM GO:0019867|"GO:outer membrane"|PF04355|IPR007450| OP:NHOMO 204 OP:NHOMOORG 204 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111----11-1------1111-1---111-----------1111---1--------111-11-----------------------------------------------------------111--11111111111111111111111111--11-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111-111---------11-11111111111111111111111111-1-11111111111111111----------11111111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 73.2 SQ:SECSTR ###################TEEEEEEEEcccccccccccHHHHHHccTTccHHHHHHHHccccEEEEEccccEEEEEEccccccccTTcEEEEEEETTEEE########### DISOP:02AL 1-1,110-113| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHccccccHHHHHHHHccccccccccccEEEEEEEEcccccccEEEEEEEEEccccEEEEccccccccc //