[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68068.1
DDBJ      :             protein YaiI
Swiss-Prot:YAII_SALTY   RecName: Full=UPF0178 protein yaiI;

Homologs  Archaea  0/68 : Bacteria  364/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PFM   18->142 PF02639 * DUF188 2e-31 56.0 %
:HMM:PFM   17->143 PF02639 * DUF188 8.8e-54 56.7 127/130  
:BLT:SWISS 1->151 YAII_SALTY 2e-84 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68068.1 GT:GENE ACF68068.1 GT:PRODUCT protein YaiI GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 487340..487795 GB:FROM 487340 GB:TO 487795 GB:DIRECTION + GB:PRODUCT protein YaiI GB:NOTE identified by match to protein family HMM PF02639 GB:PROTEIN_ID ACF68068.1 GB:DB_XREF GI:194407849 LENGTH 151 SQ:AASEQ MTIWVDADACPNVIKEILYRAAERMQLPLILVANQALRVPPSRFIRTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEVLEKGAAALNPRGERYSDATIRERLTMRDFMDTLRASGVQTGGPNTLSPRDRQHFAAELDKWWLESQRKK GT:EXON 1|1-151:0| SW:ID YAII_SALTY SW:DE RecName: Full=UPF0178 protein yaiI; SW:GN Name=yaiI; OrderedLocusNames=STM0387; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->151|YAII_SALTY|2e-84|100.0|151/151| RP:PFM:NREP 1 RP:PFM:REP 18->142|PF02639|2e-31|56.0|125/130|DUF188| HM:PFM:NREP 1 HM:PFM:REP 17->143|PF02639|8.8e-54|56.7|127/130|DUF188| OP:NHOMO 365 OP:NHOMOORG 364 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1-----------------------------------------------------------------1----------------------------------------------11111111111111111111111111---1--111111-1--------------------1----------------------------------------------------------------------1111-------1-11-111----1-----1--1111-1-1-----------11111111-1-11111111111111111111111-11111-11111-11111111111111111111111111111111111-111-111------------------------------1-11-111-11111111-----111------11--11-----------------111-2111---------1-1111--11-1--11----111111111----1--1--------------------1--1111111111111111111111111111111111----111------11111111111111111-111111111111111111111111--111-1111111111111111111111-111111111111---1-----1111-1111---------------11111111111111111111111111------------11111111111111111-1-11111------1---------------11--------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 47.0 SQ:SECSTR ######################################################################cccHHHHHHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccGGGcccHHHHHHHHHHH########## DISOP:02AL 113-131,150-152| PSIPRED cEEEEEcccccHHHHHHHHHHHHHHccEEEEEEcccccccccccEEEEEEcccccHHHHHHHHHcccccEEEEcccHHHHHHHHcccEEEccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcc //