[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68091.1
DDBJ      :             NAD-dependent deacetylase
Swiss-Prot:NPD_SALTY    RecName: Full=NAD-dependent deacetylase;         EC=3.5.1.-;AltName: Full=Regulatory protein SIR2 homolog;

Homologs  Archaea  35/68 : Bacteria  494/915 : Eukaryota  127/199 : Viruses  2/175   --->[See Alignment]
c.31.1
:273 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->273 1s5pA PDBj e-111 87.4 %
:RPS:PDB   37->266 2b4yB PDBj 3e-20 33.9 %
:RPS:SCOP  37->273 1iciA  c.31.1.5 * 4e-60 38.0 %
:HMM:SCOP  13->269 1j8fA_ c.31.1.5 * 4e-73 38.6 %
:RPS:PFM   48->221 PF02146 * SIR2 8e-31 43.6 %
:HMM:PFM   48->221 PF02146 * SIR2 2.7e-51 39.3 173/181  
:HMM:PFM   210->244 PF03033 * Glyco_transf_28 7.5e-05 35.3 34/139  
:BLT:SWISS 1->273 NPD_SALTY e-138 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68091.1 GT:GENE ACF68091.1 GT:PRODUCT NAD-dependent deacetylase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1311115..1311936 GB:FROM 1311115 GB:TO 1311936 GB:DIRECTION + GB:PRODUCT NAD-dependent deacetylase GB:NOTE identified by match to protein family HMM PF02146 GB:PROTEIN_ID ACF68091.1 GB:DB_XREF GI:194407872 LENGTH 273 SQ:AASEQ MQSRRFHRLSRFRKNKRLLRERLRQRIFFRDRVVPEMMENPRVLVLTGAGISAESGIRTFRAADGLWEEHRVEDVATPEGFARNPGLVQTFYNARRQQLQQPEIQPNAAHLALAKLEEALGDRFLLVTQNIDNLHERAGNRNIIHMHGELLKVRCSQSGQILEWNGDVMPEDKCHCCQFPAPLRPHVVWFGEMPLGMDEIYMALSMADIFIAIGTSGHVYPAAGFVHEAKLHGAHTVELNLEPSQVGSEFEEKHYGPASQVVPEFVDKFLKGL GT:EXON 1|1-273:0| SW:ID NPD_SALTY SW:DE RecName: Full=NAD-dependent deacetylase; EC=3.5.1.-;AltName: Full=Regulatory protein SIR2 homolog; SW:GN Name=npdA; Synonyms=cobB; OrderedLocusNames=STM1221; SW:KW Complete proteome; Cytoplasm; Hydrolase; Metal-binding; NAD; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->273|NPD_SALTY|e-138|100.0|273/273| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| SEG 11->32|rfrknkrllrerlrqriffrdr| SEG 108->120|aahlalakleeal| BL:PDB:NREP 1 BL:PDB:REP 41->273|1s5pA|e-111|87.4|223/225| RP:PDB:NREP 1 RP:PDB:REP 37->266|2b4yB|3e-20|33.9|224/259| RP:PFM:NREP 1 RP:PFM:REP 48->221|PF02146|8e-31|43.6|172/178|SIR2| HM:PFM:NREP 2 HM:PFM:REP 48->221|PF02146|2.7e-51|39.3|173/181|SIR2| HM:PFM:REP 210->244|PF03033|7.5e-05|35.3|34/139|Glyco_transf_28| GO:PFM:NREP 6 GO:PFM GO:0006342|"GO:chromatin silencing"|PF02146|IPR003000| GO:PFM GO:0006476|"GO:protein amino acid deacetylation"|PF02146|IPR003000| GO:PFM GO:0008270|"GO:zinc ion binding"|PF02146|IPR003000| GO:PFM GO:0016811|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides"|PF02146|IPR003000| GO:PFM GO:0045449|"GO:regulation of transcription"|PF02146|IPR003000| GO:PFM GO:0070403|"GO:NAD binding"|PF02146|IPR003000| RP:SCP:NREP 1 RP:SCP:REP 37->273|1iciA|4e-60|38.0|234/256|c.31.1.5| HM:SCP:REP 13->269|1j8fA_|4e-73|38.6|249/0|c.31.1.5|1/1|DHS-like NAD/FAD-binding domain| OP:NHOMO 763 OP:NHOMOORG 658 OP:PATTERN 11---11111111111-12222221--1---11----------------1---11111111---1--1 1-1-11-211111111111-11111111111111111---------11--------1----111111-1-1----11-1-1111-11111111111---11111111111---------------1----1---1-11133---5-1------------------------------------11111----11111111111111111111111111222-1--111111111111111111111111111111111111111111111-1-111----------1--------------------------1----------1-1111111111111111111-11111111-1---111-11-112-111111-111-----1-111---11111------------11111111--1--------------11--1-11111111---------11--111------------------------------1111----11------1------1---------12121--1111-1111---1---1----1-----------211122111---11----------11111111122----1111111111111111--111--11-111--1-11111111111111111111--1-21-------111111111111111-1-1111111111111111111111111111111111111111111111111111-111111111111-------------1121----11--2-22---11111111-111-111111-111--21322----------1111111111111111---------------1111111--------1-1----------1--------------1111111111-1- 11------311---1111-111111111111111111111111-11111111211-1---111111------111-----12211------21322-------------118334241121-211222-493-3332121411121111122-2111121-222111---1-131----------2--11-2--1--1- -------------------1--------------------------------------------------------------------------------------------------------------------------------------------1-------------- STR:NPRED 241 STR:RPRED 88.3 SQ:SECSTR ################################HHHHHHHccEEEEEEcGGGGGGGTccccccTTcHcTTccGGGTccHHHHHHcHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHTTTcEEEEEEcccccHHHHTTcccEEETTEEEEEEEETTTccEEEccccGGGccccccTTTcccEEEEEccTTccHHHHHHHHHHHHHccEEEEEccccccTTGGHHHHHHHHTTccEEEEEccccTTGGGccEEEEccHHHHHHHHTHHcHHHH DISOP:02AL 1-11,13-20| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHcccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEEcccccHHHHcccccEEEEEcccEEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccEEEEEccccEEccHHHHHHHHHHccccEEEEccccccccccEEEEEEccHHHHHHHHHHHHHHcc //