[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68101.1
DDBJ      :             aldolase class II protein YgbL
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  251/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.74.1
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->170 1dzwP PDBj 1e-14 31.2 %
:RPS:PDB   7->212 1e4cP PDBj 1e-32 26.0 %
:RPS:SCOP  7->212 1dzuP  c.74.1.1 * 1e-31 27.0 %
:HMM:SCOP  3->212 1gt7A_ c.74.1.1 * 7.7e-57 40.0 %
:RPS:PFM   13->142 PF00596 * Aldolase_II 6e-20 44.4 %
:HMM:PFM   13->190 PF00596 * Aldolase_II 3.9e-47 38.2 173/183  
:BLT:SWISS 1->211 YGBL_ECOLI 7e-74 64.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68101.1 GT:GENE ACF68101.1 GT:PRODUCT aldolase class II protein YgbL GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(3033418..3034056) GB:FROM 3033418 GB:TO 3034056 GB:DIRECTION - GB:PRODUCT aldolase class II protein YgbL GB:NOTE identified by match to protein family HMM PF00596 GB:PROTEIN_ID ACF68101.1 GB:DB_XREF GI:194407882 LENGTH 212 SQ:AASEQ MTILAKEEHALREEMVRIAASFFQRGYATGSAGNLSLLLPDGNILATPTGSCLGNLDPQRLSKVDPQGEWLNGDKPSKEVRFHLALYRNNPCCKAVVHLHSTWSTALSCLEGLDPQNVIRPFTPYVVMRMGDIPLVPYYRPGDDRIARDLAALAARHQAFLLANHGPVVCGENLQEAANNTEELEETAKLIFILGERPIRYLTTEEIAQLRR GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 1->211|YGBL_ECOLI|7e-74|64.9|211/212| SEG 143->163|ddriardlaalaarhqaflla| SEG 172->188|enlqeaannteeleeta| BL:PDB:NREP 1 BL:PDB:REP 7->170|1dzwP|1e-14|31.2|157/206| RP:PDB:NREP 1 RP:PDB:REP 7->212|1e4cP|1e-32|26.0|200/206| RP:PFM:NREP 1 RP:PFM:REP 13->142|PF00596|6e-20|44.4|124/181|Aldolase_II| HM:PFM:NREP 1 HM:PFM:REP 13->190|PF00596|3.9e-47|38.2|173/183|Aldolase_II| GO:PFM:NREP 1 GO:PFM GO:0046872|"GO:metal ion binding"|PF00596|IPR001303| RP:SCP:NREP 1 RP:SCP:REP 7->212|1dzuP|1e-31|27.0|200/209|c.74.1.1| HM:SCP:REP 3->212|1gt7A_|7.7e-57|40.0|210/274|c.74.1.1|1/1|AraD-like aldolase/epimerase| OP:NHOMO 353 OP:NHOMOORG 277 OP:PATTERN --1---1---------1--1--1-----------111111111-----1-----111111-1-11--- 112------------11-------1------1------------1-----------------1-1-----------------111---111-------------------------------------------1-1-------11--1-11--------1-1----------------------------------------------1------------1---------------------------------------------------------------------11-1---------------------------2----1111111-1-1-----1-211-----11--11-1--1211-31---11---1-----1-222---1-1--2222222122----1--1-2----1---1132112211-1-1-21-121-1--------1111---2----------------------------------------1111111111-11111111-11-11111-111------1-121-------1-----------------1---11---111--------1111-1---1---------------------------1-----------------------------------2------1-----12112222222-121212221213211211-3321121-2122222222222222121111121-1111-11-1111-------------1--111111-1-12122221-----------------1-1------111----------1--------1---1-----------------1------------------------------------------1111--1----2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 97.2 SQ:SECSTR ######cHHHHHHHHHHHHHHHHHTTcccTTccEEEEEETTTEEEEccTTccGGGccGGGcEEEcTTccccTTccccTTHHHHHHHHHHcTTccEEEEEccHHHHHHHHHTccccccccccccGGGGGGTccccEEccccTTcHHHHHHHHHHTccccEEEETTTEEEEEEccHHHHHHHHHHHHHHHHHHHHHTccccccccHHHHHHHHH DISOP:02AL 1-2,4-4,206-206| PSIPRED cccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccEEEEEEccccHHHccHHHEEEEccccccccccccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHcccccccccHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHcccccEEEEcccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHc //