[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68105.1
DDBJ      :             secretion system effector SseB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.231.1e.6.1
:196 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  82->122 1siqA2  e.6.1.1 * 4e-04 24.3 %
:HMM:SCOP  28->192 1xouA_ a.231.1.1 * 1e-55 46.5 %
:RPS:PFM   12->189 PF03433 * EspA 5e-40 54.5 %
:HMM:PFM   1->188 PF03433 * EspA 5.9e-74 40.6 187/188  
:BLT:SWISS 53->176 ODFP2_RAT 3e-04 25.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68105.1 GT:GENE ACF68105.1 GT:PRODUCT secretion system effector SseB GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1489449..1490039 GB:FROM 1489449 GB:TO 1490039 GB:DIRECTION + GB:PRODUCT secretion system effector SseB GB:NOTE identified by match to protein family HMM PF03433 GB:PROTEIN_ID ACF68105.1 GB:DB_XREF GI:194407886 LENGTH 196 SQ:AASEQ MSSGNILWGSQNPIVFKNSFGVSNTDTGSQDDLSQQNPFAEGYGVLLILLMVIQAIANDKFIEVQKNAERARNTQEKSNEMDEVIAKAAKGDAKTKEEVPEDVIKYMRDNGILIDGMTIDEYMAKYGDHGKLDKGGLQAVKAALDNDANRNTDLMSQGQITIQKMSQELNAVLTQLTGLISKWGEISSMIAQKTYS GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 53->176|ODFP2_RAT|3e-04|25.0|120/825| TM:NTM 1 TM:REGION 41->63| RP:PFM:NREP 1 RP:PFM:REP 12->189|PF03433|5e-40|54.5|178/185|EspA| HM:PFM:NREP 1 HM:PFM:REP 1->188|PF03433|5.9e-74|40.6|187/188|EspA| RP:SCP:NREP 1 RP:SCP:REP 82->122|1siqA2|4e-04|24.3|37/236|e.6.1.1| HM:SCP:REP 28->192|1xouA_|1e-55|46.5|157/0|a.231.1.1|1/1|EspA/CesA-like| OP:NHOMO 26 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------4-------------------------------------------------------------------------------------2-2--------------------------------1----------------------------------------1111111111111111--------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,32-32,65-77,88-98,192-192,194-197| PSIPRED cccccEEEcccccEEccccccccccccccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccHHHHHHHHHcccccccEEHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //