[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68127.1
DDBJ      :             lambda phage ciii
Swiss-Prot:RPC3_BPP22   RecName: Full=Regulatory protein C3;AltName: Full=CIII;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:42 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->35 PF02061 * Lambda_CIII 3e-11 89.3 %
:HMM:PFM   1->35 PF02061 * Lambda_CIII 2.2e-28 88.6 35/45  
:BLT:SWISS 1->42 RPC3_BPP22 8e-22 100.0 %
:PROS 8->29|PS00553|LAMBDA_PHAGE_CIII

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68127.1 GT:GENE ACF68127.1 GT:PRODUCT lambda phage ciii GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(383040..383168) GB:FROM 383040 GB:TO 383168 GB:DIRECTION - GB:PRODUCT lambda phage ciii GB:NOTE identified by match to protein family HMM PF02061 GB:PROTEIN_ID ACF68127.1 GB:DB_XREF GI:194407908 LENGTH 42 SQ:AASEQ MGVSQLHESLLDRITRKLRAGWKRLADILNQPGVPSHDYCAC GT:EXON 1|1-42:0| SW:ID RPC3_BPP22 SW:DE RecName: Full=Regulatory protein C3;AltName: Full=CIII; SW:GN Name=C3; SW:KW Activator; Early protein; Transcription; Transcription regulation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->42|RPC3_BPP22|8e-22|100.0|42/52| GO:SWS:NREP 2 GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 8->29|PS00553|LAMBDA_PHAGE_CIII|PDOC00478| RP:PFM:NREP 1 RP:PFM:REP 8->35|PF02061|3e-11|89.3|28/43|Lambda_CIII| HM:PFM:NREP 1 HM:PFM:REP 1->35|PF02061|2.2e-28|88.6|35/45|Lambda_CIII| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-1---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------1-----1------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,36-37| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //