[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68140.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:YDIA_SALTY   RecName: Full=Putative phosphotransferase ydiA;         EC=2.7.-.-;

Homologs  Archaea  0/68 : Bacteria  497/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
a.37.1
:277 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   122->171 2yyzA PDBj 2e-04 51.2 %
:HMM:SCOP  177->234 1sknP_ a.37.1.1 * 0.00085 25.9 %
:RPS:PFM   9->267 PF03618 * DUF299 4e-54 52.3 %
:HMM:PFM   9->267 PF03618 * DUF299 3.8e-84 43.2 243/255  
:BLT:SWISS 1->277 YDIA_SALTY e-150 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68140.1 GT:GENE ACF68140.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1431643..1432476) GB:FROM 1431643 GB:TO 1432476 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF03618 GB:PROTEIN_ID ACF68140.1 GB:DB_XREF GI:194407921 LENGTH 277 SQ:AASEQ MDNVVDRHVFYISDGTAITAEVLGHAVMSQFPVTISSITLPFVENESRARAVKDQIDAIYQQTGVRPLVFYSIVLPEIRAIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDGISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDMDNLTLPTSLKPLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYSVEEIATKILDIMGLNRRMY GT:EXON 1|1-277:0| SW:ID YDIA_SALTY SW:DE RecName: Full=Putative phosphotransferase ydiA; EC=2.7.-.-; SW:GN Name=ydiA; OrderedLocusNames=STM1348; SW:KW ATP-binding; Complete proteome; Kinase; Nucleotide-binding;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->277|YDIA_SALTY|e-150|100.0|277/277| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 212->223|erlaaireerre| BL:PDB:NREP 1 BL:PDB:REP 122->171|2yyzA|2e-04|51.2|43/358| RP:PFM:NREP 1 RP:PFM:REP 9->267|PF03618|4e-54|52.3|241/255|DUF299| HM:PFM:NREP 1 HM:PFM:REP 9->267|PF03618|3.8e-84|43.2|243/255|DUF299| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF03618|IPR005177| GO:PFM GO:0016772|"GO:transferase activity, transferring phosphorus-containing groups"|PF03618|IPR005177| HM:SCP:REP 177->234|1sknP_|0.00085|25.9|54/74|a.37.1.1|1/1|A DNA-binding domain in eukaryotic transcription factors| OP:NHOMO 531 OP:NHOMOORG 510 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------1----11---------1---------------111------------------------------------------------------111------1-------------------------------------111-----111111111111111111111111111111111111111112211111111111111122222111111-11111--11211---------1---1--------------------------1--------1-11-1111111111--1---1-1-1-211--111111121111111-------111111111111111111111111111111111-11111111111-11111111111111111----------11111111111-11111111111111--1111111111111111111111-111111111111111111111111111111111111111111111111111111111111111112111111-1-2----------111111111-----1-----------------------------11111-1111-1111111111111111111--1-111------11111111111111111-1111111111111111111111111111111111111111111111111111-1111111-1111---1-----1111-1111---------------11111111111-11111111111111111-------------1111111111111111111111111----------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1118--1--1112-211------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 43 STR:RPRED 15.5 SQ:SECSTR #########################################################################################################################EEEEEETTEEEEE#######EEEEEEcTTcEEEEEccTTccHHHHHHHHH########################################################################################################## DISOP:02AL 1-5,106-117,224-224,275-278| PSIPRED ccccccEEEEEEEcHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHccccEEEcHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEcccccHHHHHHHHccccEEEEEcccccccccccccHHHHHccccEEEEEEcHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHHHHHccc //