[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68144.1
DDBJ      :             type VI secretion protein, family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  165/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:447 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  291->438 1fg3A  c.67.1.1 * 4e-04 19.4 %
:RPS:PFM   20->444 PF05936 * DUF876 5e-83 41.8 %
:HMM:PFM   20->445 PF05936 * DUF876 7.8e-141 42.4 422/425  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68144.1 GT:GENE ACF68144.1 GT:PRODUCT type VI secretion protein, family GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 327739..329082 GB:FROM 327739 GB:TO 329082 GB:DIRECTION + GB:PRODUCT type VI secretion protein, family GB:NOTE identified by match to protein family HMM PF05936; match to protein family HMM TIGR03353 GB:PROTEIN_ID ACF68144.1 GB:DB_XREF GI:194407925 LENGTH 447 SQ:AASEQ MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGFSHYNIDGEALNIGKLILKEASGIFPDGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPVRAPNSEETTFDNNPESLARFSVHEHDIRDANSLGRGAQLLQLSHLRLRLLPEKAVTGAWIGLPLTRITGLNPDGRIDIDHDLIPPIINYQASSLMCTWLSWINDLIRMRADSLAERLTGSDNHGHEAAEVSDYLLLQILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRPQTRRPAEYKEYKHLTPYAGLKSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSDLADFSTLVLAIKASMPTDVLLQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQIPFQAGYIYYDIRREGALWEHIARYGGMAMHTAGEFPGLETELWGVRDK GT:EXON 1|1-447:0| SEG 78->94|pdhtplpppltilpehl| SEG 142->154|qllqlshlrlrll| SEG 180->191|ididhdlippii| RP:PFM:NREP 1 RP:PFM:REP 20->444|PF05936|5e-83|41.8|421/425|DUF876| HM:PFM:NREP 1 HM:PFM:REP 20->445|PF05936|7.8e-141|42.4|422/425|DUF876| RP:SCP:NREP 1 RP:SCP:REP 291->438|1fg3A|4e-04|19.4|134/355|c.67.1.1| OP:NHOMO 273 OP:NHOMOORG 165 OP:PATTERN -------------------------------------------------------------------- --2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------1---1---111-2-1----1-----111-11-----------1-------------------------------------------11-23111122233322215555143312-1---1-11-1--1---2--------1------------11-------------------11-1-----11---1----------1--------------111-11-----------1-----------1----1---------2-11-1-11--11111-1--1--11-1111-----111111331--1121-1111111111------1--155555525554---1-----------1-1----1----------------1---1-2222111123221-211----------21211211-12211--1-2--322--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,111-118,217-232| PSIPRED cccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcHHHHHcccEEEEEEEEEcccccEEEccccccccccccccccccccEEEEEEEEcccccccccccccccccEEEEEEEEEccHHHcccccccEEEEcccEEEEEEcccccccEEEEEEEEEEEEcccccEEEcccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEEEccHHHcccccEEEEEEccccHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccccccEEEEEccccHHHHHHHHcccEEEEEcccccccEEEEEEEEcc //