[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68188.1
DDBJ      :             flavodoxin
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  212/915 : Eukaryota  32/199 : Viruses  0/175   --->[See Alignment]
c.23.5
:149 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->148 2hnaA PDBj 3e-17 28.8 %
:RPS:PDB   4->148 1akwA PDBj 1e-19 16.0 %
:RPS:SCOP  4->148 1ykgA1  c.23.5.2 * 3e-21 26.2 %
:HMM:SCOP  1->148 1tllA2 c.23.5.2 * 4.4e-36 31.7 %
:RPS:PFM   6->122 PF00258 * Flavodoxin_1 7e-12 36.8 %
:HMM:PFM   6->140 PF00258 * Flavodoxin_1 2.6e-27 31.1 135/143  
:BLT:SWISS 1->149 YQCA_SHIFL 3e-63 77.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68188.1 GT:GENE ACF68188.1 GT:PRODUCT flavodoxin GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(3097715..3098164) GB:FROM 3097715 GB:TO 3098164 GB:DIRECTION - GB:PRODUCT flavodoxin GB:NOTE identified by match to protein family HMM PF00258 GB:PROTEIN_ID ACF68188.1 GB:DB_XREF GI:194407969 LENGTH 149 SQ:AASEQ MAEIGIFVGTMYGNSLLVAEEAEAILARQGHSATVFEDPELSDWQQYQDKVALVVTSTTGQGDLPDSIAPLFHGIKDTVGFQPNLRYGVIALGDSSYPNFCNGGKQFDALLQEQSAQRVGEILFIDASEHPEPESQSNPWVENWGTLLS GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 1->149|YQCA_SHIFL|3e-63|77.9|149/149| SEG 19->24|aeeaea| BL:PDB:NREP 1 BL:PDB:REP 1->148|2hnaA|3e-17|28.8|146/147| RP:PDB:NREP 1 RP:PDB:REP 4->148|1akwA|1e-19|16.0|144/147| RP:PFM:NREP 1 RP:PFM:REP 6->122|PF00258|7e-12|36.8|114/137|Flavodoxin_1| HM:PFM:NREP 1 HM:PFM:REP 6->140|PF00258|2.6e-27|31.1|135/143|Flavodoxin_1| GO:PFM:NREP 2 GO:PFM GO:0010181|"GO:FMN binding"|PF00258|IPR008254| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00258|IPR008254| RP:SCP:NREP 1 RP:SCP:REP 4->148|1ykgA1|3e-21|26.2|141/146|c.23.5.2| HM:SCP:REP 1->148|1tllA2|4.4e-36|31.7|145/0|c.23.5.2|1/1|Flavoproteins| OP:NHOMO 389 OP:NHOMOORG 244 OP:PATTERN -------------------------------------------------------------------- --------------111-------------------1-11--------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------111-1----11-------------111111111111111--1-----------------------------------------------------------------------------------------------------------------------------11-----------111----------------------------------------------------------------------------------------------------------------------------------------1-1------------11-------1------2-----1--------------------------------1----------------------------11321211212212222222333333333342-------------22222222222222222-2222222222222222222222222222222222222222222222222223-222222222222--1----------1-11-111112111111111-----------111111111111111111----------1222222222212211----------------11--------------------------------------------------1-1 -------------------------------------------------------------------------------------------------------------------1211-1-1-1-111282-11111111111-11-1-11-2-1-1----------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 99.3 SQ:SECSTR TccEEEEEEccccHHHHHHHHHHHHHHTTTcEEEEEEGGGcccTTTTTTccEEEEEEcccccccccccTTTHHHHHTGGcccTTcEEEEEEEEcTTcccTTHHHHHHHHHHHHTTcEEccccEEEEccGGHGGHHHHHHHHHHHHTTc# PSIPRED ccEEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEcccccHHHcccccEEEEEEcccccccccHHHHHHHHHHHcccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHccccEEcccEEEEccccccHHHHHHHHHHHHHHHHc //