[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68197.1
DDBJ      :             ribosomal-protein-serine acetyltransferase
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  149/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:179 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->179 1s7nB PDBj e-103 98.3 %
:RPS:PDB   62->177 3dnsA PDBj 8e-19 13.4 %
:RPS:SCOP  1->176 1s7fA1  d.108.1.1 * 6e-18 90.2 %
:HMM:SCOP  3->175 1s7kA1 d.108.1.1 * 8.3e-45 28.9 %
:HMM:PFM   76->151 PF00583 * Acetyltransf_1 2.6e-10 24.0 75/83  
:HMM:PFM   25->78 PF08270 * PRD_Mga 0.00032 13.0 54/217  
:BLT:SWISS 1->178 RIML_ECOLI 9e-70 68.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68197.1 GT:GENE ACF68197.1 GT:PRODUCT ribosomal-protein-serine acetyltransferase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1749127..1749666) GB:FROM 1749127 GB:TO 1749666 GB:DIRECTION - GB:PRODUCT ribosomal-protein-serine acetyltransferase GB:NOTE identified by match to protein family HMM PF00583 GB:PROTEIN_ID ACF68197.1 GB:DB_XREF GI:194407978 LENGTH 179 SQ:AASEQ MVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNMLLHQRGYAKMYLIFCQNEMAGVLSFNAIEPVNKAAYIGYWLDESLQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAD GT:EXON 1|1-179:0| BL:SWS:NREP 1 BL:SWS:REP 1->178|RIML_ECOLI|9e-70|68.0|178/179| BL:PDB:NREP 1 BL:PDB:REP 1->179|1s7nB|e-103|98.3|179/179| RP:PDB:NREP 1 RP:PDB:REP 62->177|3dnsA|8e-19|13.4|112/126| HM:PFM:NREP 2 HM:PFM:REP 76->151|PF00583|2.6e-10|24.0|75/83|Acetyltransf_1| HM:PFM:REP 25->78|PF08270|0.00032|13.0|54/217|PRD_Mga| RP:SCP:NREP 1 RP:SCP:REP 1->176|1s7fA1|6e-18|90.2|173/173|d.108.1.1| HM:SCP:REP 3->175|1s7kA1|8.3e-45|28.9|173/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 168 OP:NHOMOORG 161 OP:PATTERN --------------------------------------1111---------11--------1-1---- --1------------------------------------------------11-------------1--------------------------------------1-----------------------------------------------------1---------1---------------------1-11111111111111111-111111-1-11211------1-11111111111111111-11---2112----21--11----21------------------------------------------------1-------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------1----------------------------1-----------------------------11------------------------1----------------11--11-1111111111--1111111-1-1111111111111---1111111111111111-1111111----------------------------1-1------1---------------------1111-----------1-----------1111-------111------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------1-------------------------------------------------111------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 100.0 SQ:SECSTR cccEEEccTTcEEEEccGGGHHHHHHHTTTTccEEETTEEEccHHHHHHHHHHHHHcccEEEcTTcTTEEEEEETTcEEEEEEEEEEETTTTEEEEEEccccGGcccHHHHHHHHHHHHHHHHHccccEEEEEEEEETTcccHHHHHTTcEEEEEEEEEEEETTEEEEEEEEEEHHHHc DISOP:02AL 179-180| PSIPRED ccEEEEccccEEEEEccHHHHHHHHHHHHccHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccEEEEEEEccEEEEEEEEEEEcccccEEEEEEEEcHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHcccEEEEEEcccEEEccEEEEEEEEEEEEccc //