[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68220.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:BSSS_ECOLI   RecName: Full=Biofilm regulator bssS;

Homologs  Archaea  0/68 : Bacteria  74/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 2->85 BSSS_ECOLI 2e-43 94.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68220.1 GT:GENE ACF68220.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1251998..1252255) GB:FROM 1251998 GB:TO 1252255 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF68220.1 GB:DB_XREF GI:194408001 LENGTH 85 SQ:AASEQ MMEKNNEVIQTHPLVGWDISTVDSYDALMLRLHYQTPNRPEPEGTEVGQTLWLTTDVARQFISILEAGIAKIESGDYQENEYRRH GT:EXON 1|1-85:0| SW:ID BSSS_ECOLI SW:DE RecName: Full=Biofilm regulator bssS; SW:GN Name=bssS; Synonyms=yceP; OrderedLocusNames=b1060, JW5152; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 2->85|BSSS_ECOLI|2e-43|94.0|84/84| OP:NHOMO 74 OP:NHOMOORG 74 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111-11111111111111111111111111111111111111111111-11-1-11-1---111-1111--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,36-45,79-86| PSIPRED cccccccEEEEcccccccccccccHHHHEHHEEEcccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHcccccccccccc //