[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68242.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:43 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->32 PF08075 * NOPS 0.00073 36.4 22/52  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68242.1 GT:GENE ACF68242.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1997794..1997925 GB:FROM 1997794 GB:TO 1997925 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF68242.1 GB:DB_XREF GI:194408023 LENGTH 43 SQ:AASEQ MANSLLVIVKRRTKKPHFLTGAFAYVDYAEKWTAKLVVPQLAY GT:EXON 1|1-43:0| HM:PFM:NREP 1 HM:PFM:REP 10->32|PF08075|0.00073|36.4|22/52|NOPS| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccEEEEEEEEccccccEEEEHHHHEHHHHHHEEEEccccccc //