[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68274.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:320 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->45 PF12276 * DUF3617 6.9e-05 32.4 37/162  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68274.1 GT:GENE ACF68274.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2704270..2705232) GB:FROM 2704270 GB:TO 2705232 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF68274.1 GB:DB_XREF GI:194408055 LENGTH 320 SQ:AASEQ MQATVKRRLTKVALALVVAGYCAAPAVAANGNLKSGQWQIVSEQTGTIQGTVPWITRAADKTADTDKDHVTVTIDRGDRKIVTEGDKQFHVGDKVTVNWAIGDTEGDLDVDNAATKLTVQWMRYSDQNGSNPEEIGTKGSDTYEIQAGDADHYIGIKITPTTTTGDPAVATELLLKDLSTDAGGGSDDDEIPEGPVVDENVHVVIYESGSTTNLLGTSTPLKTDTTYKVLLWSDKNSNGTYDTGEDVTSQYDYRWKFVGTSKIAGTGTGGIVNESWNDKDLVIPVTNVDAKAAFEGAEGGVTVGSDGVQGFGLSIDYKRK GT:EXON 1|1-320:0| SEG 17->29|vvagycaapavaa| SEG 58->73|aadktadtdkdhvtvt| SEG 159->164|tptttt| SEG 208->219|sgsttnllgtst| HM:PFM:NREP 1 HM:PFM:REP 7->45|PF12276|6.9e-05|32.4|37/162|DUF3617| OP:NHOMO 45 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-222-------222-2--12-----2--------2-11221222212112------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,180-190,319-321| PSIPRED ccHHHHHHHHHHHHHHHHHccccccEEEccccccccEEEEEEEcccEEEEEcccEEEcccccccccccEEEEEEEcccEEEEEccccEEEEccEEEEEEEEccccccccccccccEEEEEEEEEEccccccHHHHccccccccEEEccccccEEEEEEEEcccccccccEEEEEEEEcccccccccccccccccccccccccEEEEEccccEEEcccccEEEcccEEEEEEEEccccccEEEcHHHHHHcccEEEEEEEEEEEEcccccEEEEEEccccEEEEEcccHHHHHHHccccccccccccccEEEEEEEEEEEc //