[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68323.1
DDBJ      :             putative fimbrial protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.2.3
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   62->184 3bwuF PDBj 1e-05 18.1 %
:RPS:SCOP  49->184 1pdkB  b.2.3.2 * 3e-09 18.7 %
:HMM:SCOP  39->185 1pdkB_ b.2.3.2 * 2.5e-06 27.5 %
:HMM:PFM   32->184 PF00419 * Fimbrial 4.9e-05 30.3 142/153  
:BLT:SWISS 28->184 YADL_ECOLI 7e-15 31.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68323.1 GT:GENE ACF68323.1 GT:PRODUCT putative fimbrial protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(213136..213693) GB:FROM 213136 GB:TO 213693 GB:DIRECTION - GB:PRODUCT putative fimbrial protein GB:PROTEIN_ID ACF68323.1 GB:DB_XREF GI:194408104 LENGTH 185 SQ:AASEQ MKFTSALITLSVSAVLFSGMGRAAITGTDSVQMTFKTTVTTGTCKAIVVNGDGKNVSTIGYGETYKSDLNKKAMPLSIVFSNCSGVTIAEVEAKAGTGGTCSGDNLDGDSYAAGLNTAFEIWGGDADTGVKLSCKTPPAAQEVTITNGAGTYPMTSRIVVANGKSLSDVTAGDVTAPVTFVVTYP GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 28->184|YADL_ECOLI|7e-15|31.4|156/201| TM:NTM 1 TM:REGION 2->24| SEG 34->43|tfkttvttgt| RP:PDB:NREP 1 RP:PDB:REP 62->184|3bwuF|1e-05|18.1|116/128| HM:PFM:NREP 1 HM:PFM:REP 32->184|PF00419|4.9e-05|30.3|142/153|Fimbrial| RP:SCP:NREP 1 RP:SCP:REP 49->184|1pdkB|3e-09|18.7|134/149|b.2.3.2| HM:SCP:REP 39->185|1pdkB_|2.5e-06|27.5|142/0|b.2.3.2|1/1|Bacterial adhesins| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------111111111--1-111-111111-111111--------1--1-1--11-1-11--------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 62.7 SQ:SECSTR #############################################################EEEEEcccccccEEEEEEEEEEcTTccEEEEcccccccTTcEEccccTTccccEEEEEE###cTTcccccTTccGGGccEEEccTTccEEEEEEEEEE####EccccccccccccccEEEEEE# DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHcccccEEccccEEEEEEEEEEEEEEEEEEEEEccccEEEEEEcccEEEHHccccccEEEEEEcccccccccEEEEEccccccccccccccHHHccccEEEEEEEEEccccEEEEEEEccccEEEEEEcccccccccEEEEEEEcccEEEEEccccEEccEEEEEEcc //