[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68340.1
DDBJ      :             fimbrial subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  118/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.2.3
:172 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   22->172 2jmrA PDBj 8e-25 41.3 %
:RPS:PDB   49->172 3bwuF PDBj 7e-25 38.7 %
:RPS:SCOP  24->172 2j2zB1  b.2.3.2 * 6e-26 22.5 %
:HMM:SCOP  31->172 1pdkB_ b.2.3.2 * 9.3e-38 48.6 %
:RPS:PFM   28->172 PF00419 * Fimbrial 2e-20 44.8 %
:HMM:PFM   23->172 PF00419 * Fimbrial 1.2e-36 36.5 148/153  
:BLT:SWISS 1->172 FIMF_ECOLI 1e-25 40.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68340.1 GT:GENE ACF68340.1 GT:PRODUCT fimbrial subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 31194..31712 GB:FROM 31194 GB:TO 31712 GB:DIRECTION + GB:PRODUCT fimbrial subunit GB:NOTE identified by match to protein family HMM PF00419 GB:PROTEIN_ID ACF68340.1 GB:DB_XREF GI:194408121 LENGTH 172 SQ:AASEQ MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQASAHLQFYARYLADGGAVTPGDANASATFILAYE GT:EXON 1|1-172:0| BL:SWS:NREP 1 BL:SWS:REP 1->172|FIMF_ECOLI|1e-25|40.9|171/176| BL:PDB:NREP 1 BL:PDB:REP 22->172|2jmrA|8e-25|41.3|150/179| RP:PDB:NREP 1 RP:PDB:REP 49->172|3bwuF|7e-25|38.7|124/128| RP:PFM:NREP 1 RP:PFM:REP 28->172|PF00419|2e-20|44.8|145/152|Fimbrial| HM:PFM:NREP 1 HM:PFM:REP 23->172|PF00419|1.2e-36|36.5|148/153|Fimbrial| RP:SCP:NREP 1 RP:SCP:REP 24->172|2j2zB1|6e-26|22.5|142/150|b.2.3.2| HM:SCP:REP 31->172|1pdkB_|9.3e-38|48.6|138/0|b.2.3.2|1/1|Bacterial adhesins| OP:NHOMO 549 OP:NHOMOORG 119 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---121111121--111--33333-11----1-----------------------1-------------------------------------------------------------------------11-------------------1---------------------A4--1778AAB899678-9549755A97A6A888884566-123D9475898888979759A5437774--122232222333---------------------------------222-2-------1111-1-1------1---------------------------1--------3232----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 87.8 SQ:SECSTR #####################cccccccccccccccEEcccHHccccccEEEEEccccccccccccEEEEEEEEEEcTTccEEEEEEEcccccccTTcEEccccTTccccEEEEEEcTTcccccTTccGGGccEEETTccEEEEEEEEEEEccccccccccccccEEEEEEc PSIPRED cHHHHHHHHHHHHHHccEEccccEEEEEEEEEccccEEEccccEEEEEcccccHHHccccccccccEEEEEEEEEccccccEEEEEEEEccccccccEEEEEcccccccEEEEEEEEccccEEEccccccEEEEcccccEEEEEEEEEEEEcccccccEEEEEEEEEEEEEc //