[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68349.1
DDBJ      :             cobalt import ATP-binding protein CbiO
Swiss-Prot:CBIO_SALTI   RecName: Full=Cobalt import ATP-binding protein cbiO;         EC=3.6.3.-;

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:271 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->238 3gfoA PDBj 2e-52 39.9 %
:RPS:PDB   6->230 3b5jA PDBj 3e-38 25.1 %
:RPS:SCOP  1->225 1b0uA  c.37.1.12 * 3e-38 27.6 %
:HMM:SCOP  6->218 1ii8.1 c.37.1.12 * 1.6e-59 36.7 %
:RPS:PFM   41->165 PF00005 * ABC_tran 9e-14 42.2 %
:HMM:PFM   41->165 PF00005 * ABC_tran 1.8e-21 31.6 117/118  
:BLT:SWISS 1->271 CBIO_SALTI e-155 98.9 %
:PROS 137->151|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68349.1 GT:GENE ACF68349.1 GT:PRODUCT cobalt import ATP-binding protein CbiO GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2148814..2149629) GB:FROM 2148814 GB:TO 2149629 GB:DIRECTION - GB:PRODUCT cobalt import ATP-binding protein CbiO GB:NOTE identified by match to protein family HMM PF00005; match to protein family HMM TIGR01166 GB:PROTEIN_ID ACF68349.1 GB:DB_XREF GI:194408130 LENGTH 271 SQ:AASEQ MLATSDLWFRYQDEPVLKGLNLDFSLSPVTGLVGANGCGKSTLFMNLSGLLRPQKGAVLWQGKPLDYSKRGLLALRQQVATVFQDPEQQIFYTDIDSDIAFSLRNLGVPEAEITRRVDEALTLVDAQHFRHQPIQCLSHGQKKRVAIAGALVLQARYLLLDEPTAGLDPAGRTQMLAIIRRIVAQGNHVIISSHDIDLIYEISDAVYVLRQGQILTHGAPGEVFACTEAMEQAGLTQPWLVKLHTQLGLPLCKTETEFFHRMQKCAFREAS GT:EXON 1|1-271:0| SW:ID CBIO_SALTI SW:DE RecName: Full=Cobalt import ATP-binding protein cbiO; EC=3.6.3.-; SW:GN Name=cbiO; OrderedLocusNames=STY2223, t0854; SW:KW ATP-binding; Cell inner membrane; Cell membrane; Cobalt;Cobalt transport; Complete proteome; Hydrolase; Ion transport;Membrane; Nucleotide-binding; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->271|CBIO_SALTI|e-155|98.9|271/271| GO:SWS:NREP 9 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006824|"GO:cobalt ion transport"|Cobalt transport| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 137->151|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->238|3gfoA|2e-52|39.9|238/251| RP:PDB:NREP 1 RP:PDB:REP 6->230|3b5jA|3e-38|25.1|223/243| RP:PFM:NREP 1 RP:PFM:REP 41->165|PF00005|9e-14|42.2|116/123|ABC_tran| HM:PFM:NREP 1 HM:PFM:REP 41->165|PF00005|1.8e-21|31.6|117/118|ABC_tran| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->225|1b0uA|3e-38|27.6|225/258|c.37.1.12| HM:SCP:REP 6->218|1ii8.1|1.6e-59|36.7|210/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 43764 OP:NHOMOORG 1170 OP:PATTERN UVNAOLJMUUSQUQWPnFQNJQKXqMPgiSbSCBDDEDGEFDDQaQWeJN*yc8PaPTYPQLLEW179 SSnJ*bddhhlUWTUOPLL-Lg88S*MMMMMMpkkln***S*V*k*qgucXL*ysLQbEFywwe*q****cVSRRtXUVM*YmB8B9CQPOJ5LBEH--CFPJGCXJYKQ57777769AC9999FPLGORFHNRSOippx*FFI*YofitfefdhWYMHMILFagag**wXGPFGGEFNHJEFeZbOOlc9Thp********z********yywt***dir**bpsssqpq**SeeedebacceeecbWVPUWpbbYruYMYVbutLM**ZUMXgfbeamkponlrtnnttrplmruorqaabaZabccbaaa*lmaZamlnnh*ov********c*ej*wwXaaW*gepi*WfWJ**qhYfdfQagYhhNUVTNbQQQMGHHHIdR***RQn*****y****w*syz*-gm*fa*g***K9**************HIJ**********QPQQQQQQqSXKSbZ*55536444654543664463343356364H9CBBD***********wvtvq*****x**d********7Kvuo*fklo*w****UfcMSJNgTGGHHHGHPOMSgea**RaWnlNhkbahJZWXSTafVXXXVXmuXtGIKKCKLKNIE889AA9A99DPCFFLKmlqOqTSISInPTUWTNRbTSSSUTbWUYX5-BKTKL11-111*v**U*wr**xsywzsr-yrquxtwuwuzywmoqonn*****gfbokkllmnmnmllnlll*qlkssrqQ2************23KHAC9ABLKLKNI*l*aaYWWUHNPLJSMRdKMOMMEOELRocwtqtu***q**vxf***DDCABDCCDHYhhvkllllsusuuNMOJJJJJLJCBBB34NQONGGEF78898899*BPBAA79-87BAA99FDD9BE974889WfoTTh*fmgDcO 1133QQC-QI6BLUEA9E9BDIAFAHHAA7979HHG6HCGAEG577B8AGGIPIBEE78A98835226116157524-4545445733-9L49B6685996-9ED84ISTgNVQbQRHAC7DNIjl8fA**e3cMfGDF5YAEXRAKFDBTE9*ETNNnEb*FcIX8rRU*QXKHCCDA*A79FFhTa*AmdEA*m*xI ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 268-272| PSIPRED cEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccccHHHHHHHccEEEEcHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHccccHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHcccccHHHHHHHHHccccccccHHHHHHHHHHHHcccc //