[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68353.1
DDBJ      :             putative oxidoreductase YjhC
Swiss-Prot:             

Homologs  Archaea  32/68 : Bacteria  479/915 : Eukaryota  91/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:367 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->262 3e18B PDBj 2e-21 29.1 %
:RPS:PDB   3->255 3ec7A PDBj 4e-35 23.9 %
:RPS:SCOP  3->164 1ydwA1  c.2.1.3 * 4e-27 21.6 %
:HMM:SCOP  3->146 1ofgA1 c.2.1.3 * 9.7e-42 37.5 %
:HMM:SCOP  122->267 1zh8A2 d.81.1.5 * 2.2e-22 25.7 %
:RPS:PFM   3->117 PF01408 * GFO_IDH_MocA 1e-20 35.7 %
:RPS:PFM   130->227 PF02894 * GFO_IDH_MocA_C 3e-05 34.8 %
:HMM:PFM   3->118 PF01408 * GFO_IDH_MocA 2.9e-30 31.0 116/120  
:HMM:PFM   130->240 PF02894 * GFO_IDH_MocA_C 5.9e-18 30.3 109/115  
:BLT:SWISS 1->366 YJHC_ECOLI e-133 62.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68353.1 GT:GENE ACF68353.1 GT:PRODUCT putative oxidoreductase YjhC GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1227651..1228754 GB:FROM 1227651 GB:TO 1228754 GB:DIRECTION + GB:PRODUCT putative oxidoreductase YjhC GB:NOTE identified by match to protein family HMM PF01408; match to protein family HMM PF02894 GB:PROTEIN_ID ACF68353.1 GB:DB_XREF GI:194408134 LENGTH 367 SQ:AASEQ MTKYGVVGTGYFGAELARFMSKVEGAKITAIYDPVNAAPIAKELNCVATATMEALCTHPDVDCVIIASPNYLHKAPVIAAAKAGKHVFCEKPIALNYQDCKDMVDACKEAGVTFMAGHVMNFFHGVRHAKALIKAGEIGEVTQVHTKRNGFEDVQDEISWKKIRAKSGGHLYHHIHELDCTLFIMDETPSLVSMAAGNVAHKGEKFGDEDDVVLITLEFESGRFATLQWGSSFHYPEHYVLIEGTTGAILIDMQNTAGYLIKAGKKTHFLVHESQAEDDDRRNGNISSEMDGAIAYGKPGKRTPMWLSSIMKLEMQYLHDVINGLEPGEEFAKLLTGEAATNAIATADAATLSSNEGRKVKLTEILG GT:EXON 1|1-367:0| BL:SWS:NREP 1 BL:SWS:REP 1->366|YJHC_ECOLI|e-133|62.6|366/372| SEG 339->351|aatnaiatadaat| BL:PDB:NREP 1 BL:PDB:REP 6->262|3e18B|2e-21|29.1|247/337| RP:PDB:NREP 1 RP:PDB:REP 3->255|3ec7A|4e-35|23.9|238/328| RP:PFM:NREP 2 RP:PFM:REP 3->117|PF01408|1e-20|35.7|115/119|GFO_IDH_MocA| RP:PFM:REP 130->227|PF02894|3e-05|34.8|92/107|GFO_IDH_MocA_C| HM:PFM:NREP 2 HM:PFM:REP 3->118|PF01408|2.9e-30|31.0|116/120|GFO_IDH_MocA| HM:PFM:REP 130->240|PF02894|5.9e-18|30.3|109/115|GFO_IDH_MocA_C| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01408|IPR000683| GO:PFM GO:0008152|"GO:metabolic process"|PF02894|IPR004104| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02894|IPR004104| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02894|IPR004104| RP:SCP:NREP 1 RP:SCP:REP 3->164|1ydwA1|4e-27|21.6|162/172|c.2.1.3| HM:SCP:REP 3->146|1ofgA1|9.7e-42|37.5|144/220|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 122->267|1zh8A2|2.2e-22|25.7|140/0|d.81.1.5|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 1425 OP:NHOMOORG 602 OP:PATTERN --------2223222-25------4--4-23-111---1---1------311412323--311---11 43E-6---221-1-1-1----2---3------2223-7322--1377-1122848111--32133-22312-----------2-----1131-5------12-1322G16----------------1121-1113143388---41-13-121--111---11-1--2241-11-22111-1-421--23121222222--2-2-211-A5662612-16517-23333326Q311111111111111-----12--13--1---3--22-2-------1111---1--2112221212111111111111111--------112-14111212221111---22-23---1-3--221-11----43542-13-C111-111113-2532112122277777567777-3323314269--A55698799C781122-292--1-421--------2441-2--------------------------------211-1-1--1-111121-11-3355111111113------423A----232--6---1------------111-1-------1---1---1121---1-12--222-1-----------------------1-----22-1--2--------1-----------------1-------2--32111---1--------1---3-1---1-1111-5443442-31-11111121131113---------222233323333----221221111--216111121-----2222----------43---11112-1-11-121-----------11-11111111---111111111------2-111111------------------------222----------2---12322-6- ----211------313-11423225211112-1---1111111------245853211-1-1-3-----1--2--------11-12---222-211976---1112--32C22331--------1-------------------------1--------111143--1213--3-4----------1-3-1-1345551 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 367 STR:RPRED 100.0 SQ:SECSTR ccEEEEEcccHHHHHHHHHHHTcTTEEEEEEEcTTHHHHHHHHHTcEEEccHHHHHHcTTccEEEEcccGGGHHHHHHHHHHTTcEEEEEccccccHHHHHHHHHHHHHHTccEEEEEcGGGcHHHHHHHHHHHHTTTccEEEEEEEEcccccTTcGEEcccTTccTTHHHHTTHHHHHHHHHHTccEEEEEEEcccccTTGTEcccccccccEEEEEETTccEEEEEEETTccccEEEEEEEEcccEEcccccccHHHHHHTTccTTEETcTTTTcccccGGEEEEETTccEEEEcccHHHHHHHTTTTccTTccccccccTTccccHHHHccccHHHHHHHHHHHHHHHHHHHHTccEEcTTTTc PSIPRED cEEEEEEcccHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHccccEEccHHHHHccccccEEEEEcccHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHccccccEEEEEEEEccccccccccccccccccccEEEEHHHHHHHHHHHHHccccEEEEEEccccccccccccccccEEEEEEEEccccEEEEEEEEcccccccEEEEEEccEEEEEEccccccEEEEcccccEEEccccccccccccccEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEHHHccc //