[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68358.1
DDBJ      :             guanine nucleotide exchange factor SopE
Swiss-Prot:SOPE_SALTI   RecName: Full=Guanine nucleotide exchange factor sopE;AltName: Full=Effector protein sopE;AltName: Full=Toxin sopE;

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.168.1
:240 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   78->240 1gzsD PDBj 9e-91 98.8 %
:RPS:SCOP  76->240 1gzsB  a.168.1.1 * 4e-27 97.6 %
:HMM:SCOP  76->240 1gzsB_ a.168.1.1 * 6.8e-79 60.6 %
:RPS:PFM   2->75 PF05364 * SecIII_SopE_N 5e-24 85.1 %
:RPS:PFM   101->197 PF07487 * SopE_GEF 8e-39 76.3 %
:HMM:PFM   76->240 PF07487 * SopE_GEF 1e-110 83.6 165/165  
:HMM:PFM   2->75 PF05364 * SecIII_SopE_N 2.5e-46 82.4 74/74  
:BLT:SWISS 1->240 SOPE_SALTI e-134 98.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68358.1 GT:GENE ACF68358.1 GT:PRODUCT guanine nucleotide exchange factor SopE GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1145344..1146066) GB:FROM 1145344 GB:TO 1146066 GB:DIRECTION - GB:PRODUCT guanine nucleotide exchange factor SopE GB:NOTE identified by match to protein family HMM PF05364; match to protein family HMM PF07487 GB:PROTEIN_ID ACF68358.1 GB:DB_XREF GI:194408139 LENGTH 240 SQ:AASEQ MTKITLFPQDFRIQKQETTLLKEKSTEKNSLAKSILAVKNHFIELRSKLSERFISHKNTESSATHFHRGSASEGRAVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISKGINIAPFLQEIGEAAENAGLPGTTKNDVFTPSGAGANPFITPLISSANSKYPRMFINQHQQASFKIYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQYTP GT:EXON 1|1-240:0| SW:ID SOPE_SALTI SW:DE RecName: Full=Guanine nucleotide exchange factor sopE;AltName: Full=Effector protein sopE;AltName: Full=Toxin sopE; SW:GN Name=sopE; OrderedLocusNames=STY4609, t4303; SW:KW Complete proteome; GTPase activation;Guanine-nucleotide releasing factor; Secreted; Virulence. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->240|SOPE_SALTI|e-134|98.8|240/240| GO:SWS:NREP 4 GO:SWS GO:0005096|"GO:GTPase activator activity"|GTPase activation| GO:SWS GO:0005085|"GO:guanyl-nucleotide exchange factor activity"|Guanine-nucleotide releasing factor| GO:SWS GO:0005576|"GO:extracellular region"|Secreted| GO:SWS GO:0009405|"GO:pathogenesis"|Virulence| BL:PDB:NREP 1 BL:PDB:REP 78->240|1gzsD|9e-91|98.8|163/164| RP:PFM:NREP 2 RP:PFM:REP 2->75|PF05364|5e-24|85.1|74/74|SecIII_SopE_N| RP:PFM:REP 101->197|PF07487|8e-39|76.3|97/128|SopE_GEF| HM:PFM:NREP 2 HM:PFM:REP 76->240|PF07487|1e-110|83.6|165/165|SopE_GEF| HM:PFM:REP 2->75|PF05364|2.5e-46|82.4|74/74|SecIII_SopE_N| GO:PFM:NREP 5 GO:PFM GO:0005085|"GO:guanyl-nucleotide exchange factor activity"|PF07487|IPR016019| GO:PFM GO:0005576|"GO:extracellular region"|PF07487|IPR016019| GO:PFM GO:0009405|"GO:pathogenesis"|PF07487|IPR016019| GO:PFM GO:0031532|"GO:actin cytoskeleton reorganization"|PF07487|IPR016019| GO:PFM GO:0032862|"GO:activation of Rho GTPase activity"|PF07487|IPR016019| RP:SCP:NREP 1 RP:SCP:REP 76->240|1gzsB|4e-27|97.6|165/165|a.168.1.1| HM:SCP:REP 76->240|1gzsB_|6.8e-79|60.6|165/165|a.168.1.1|1/1|SopE-like GEF domain| OP:NHOMO 32 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----1111-1------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1122222121111121------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 70.0 SQ:SECSTR ########################################################################cccccccHHHHHHHHHHHHHHHcHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHTTccEEEETTEEEETTccccTTHHHHHHHHHHHcGGGGccHHHHHHHHHHHHHHHHHHHGGGGTTcccccHHHHHHHHHHHHHHHHcccc DISOP:02AL 1-1,19-28,239-241| PSIPRED ccEEEEEHHHEEEHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccc //