[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68371.1
DDBJ      :             type III secretion apparatus lipoprotein, YscJ/HrcJ family
Swiss-Prot:SSAJ_SALTY   RecName: Full=Secretion system apparatus lipoprotein ssaJ;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  121/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:249 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->185 1yj7D PDBj 3e-26 40.8 %
:RPS:PFM   23->185 PF01514 * YscJ_FliF 4e-12 30.4 %
:HMM:PFM   4->187 PF01514 * YscJ_FliF 4.4e-67 38.8 183/207  
:BLT:SWISS 1->249 SSAJ_SALTY e-128 98.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68371.1 GT:GENE ACF68371.1 GT:PRODUCT type III secretion apparatus lipoprotein, YscJ/HrcJ family GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1495792..1496541 GB:FROM 1495792 GB:TO 1496541 GB:DIRECTION + GB:PRODUCT type III secretion apparatus lipoprotein, YscJ/HrcJ family GB:NOTE identified by match to protein family HMM PF01514; match to protein family HMM TIGR02544 GB:PROTEIN_ID ACF68371.1 GB:DB_XREF GI:194408152 LENGTH 249 SQ:AASEQ MKVHRIVFLTVLTFFLTACDVDLYRSLPEDEANQMLALLMQHHIDAEKKQEEDGVTLRVEQSQFINAVELLRLNGYPHRQFTTADKMFPANQLVVSPQEEQQKINFLKEQRIEGMLSQMEGVINAKVTIALPTYDEGSNASPSSVAVFIKYSPQVNMEAFRVKIKDLIEMSIPGLQYSKISILMQPAEFRMVPDVPARQTFWIMDVINANKGKVEKWLMKYPYQLMLSLTGLLLGVGILIGYFCLRRRF GT:EXON 1|1-249:0| SW:ID SSAJ_SALTY SW:DE RecName: Full=Secretion system apparatus lipoprotein ssaJ;Flags: Precursor; SW:GN Name=ssaJ; OrderedLocusNames=STM1409; SW:KW Cell membrane; Cell outer membrane; Complete proteome; Lipoprotein;Membrane; Palmitate; Protein transport; Signal; Transmembrane;Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->249|SSAJ_SALTY|e-128|98.8|249/249| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009279|"GO:cell outer membrane"|Cell outer membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 2 TM:REGION 3->25| TM:REGION 224->245| SEG 225->241|lmlsltglllgvgilig| BL:PDB:NREP 1 BL:PDB:REP 23->185|1yj7D|3e-26|40.8|147/158| RP:PFM:NREP 1 RP:PFM:REP 23->185|PF01514|4e-12|30.4|161/206|YscJ_FliF| HM:PFM:NREP 1 HM:PFM:REP 4->187|PF01514|4.4e-67|38.8|183/207|YscJ_FliF| OP:NHOMO 171 OP:NHOMOORG 121 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------11--1---112------------------------------------------------------------------------111-2111221121-111-3333-2-111-------1--1---------------2-------------------------1112-------------1-------------------------------1----------1-1-------------------------------11-2-22-----1--2--1-1-1-12-1---------1111-2222222222222222--111--13-221222122121--2------------2-----------------------------11-1---11-----121-------------------11-----11111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 154 STR:RPRED 61.8 SQ:SECSTR ######################EEEEEcHHHHHHHHHHHHHTTccEEEEEcTTcEEEEEcGGGHHHHHHHHHHTTccccccccHHHHcc######cHHHHHHHHHHHHHHHHHHHHTTcTTEEEEEEEEEc###EEEEEEEccEEEEEEEEcTTcccGGGHHHHHHHHHHHcTTccGGGEEEEEE################################################################ DISOP:02AL 1-2,132-145| PSIPRED ccHHHHHHHHHHHHHHccccHHHHccccHHHHHHHHHHHHHcccccEEEEcccccEEEEEHHHHHHHHHHHHHccccccccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHEEEEEEEccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHcccccHHHEEEEEccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //