[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68380.1
DDBJ      :             chaperone, TorD family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  98/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.184.1
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->175 3efpB PDBj 8e-18 33.1 %
:RPS:PDB   1->184 3cw0A PDBj 3e-26 29.3 %
:RPS:SCOP  1->184 1n1cA  a.184.1.1 * 4e-30 16.4 %
:HMM:SCOP  1->180 1s9uA_ a.184.1.1 * 1.7e-36 36.7 %
:HMM:PFM   32->150 PF02613 * Nitrate_red_del 6.6e-20 28.6 119/136  
:BLT:SWISS 1->184 YCDY_ECOLI 4e-96 86.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68380.1 GT:GENE ACF68380.1 GT:PRODUCT chaperone, TorD family GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1231198..1231752 GB:FROM 1231198 GB:TO 1231752 GB:DIRECTION + GB:PRODUCT chaperone, TorD family GB:NOTE identified by match to protein family HMM PF06192 GB:PROTEIN_ID ACF68380.1 GB:DB_XREF GI:194408161 LENGTH 184 SQ:AASEQ MNEFSILCRVLGSLFYRQPQDPLLVPLFTLIREGKLAANWPLEQDDMLARLQKSCDITQISTDYNALFVGEECAVAPYRSAWVEGAEESEVRAFLTSRGMPLADTPADHIGTLLLAASWLEDQSAEDESEALETLFADYLLPWCNTFLGKVEAHAVTPFWRTLAPLTRDAIGAMWDELQEEDEE GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 1->184|YCDY_ECOLI|4e-96|86.4|184/184| BL:PDB:NREP 1 BL:PDB:REP 2->175|3efpB|8e-18|33.1|169/208| RP:PDB:NREP 1 RP:PDB:REP 1->184|3cw0A|3e-26|29.3|181/203| HM:PFM:NREP 1 HM:PFM:REP 32->150|PF02613|6.6e-20|28.6|119/136|Nitrate_red_del| RP:SCP:NREP 1 RP:SCP:REP 1->184|1n1cA|4e-30|16.4|183/199|a.184.1.1| HM:SCP:REP 1->180|1s9uA_|1.7e-36|36.7|177/207|a.184.1.1|1/1|TorD-like| OP:NHOMO 185 OP:NHOMOORG 98 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------21211212222222222-222222222222222222122211111332322332233333322212212--122232212232------------------222211112221112------------------------------------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 100.0 SQ:SECSTR cTTHHHHHHHHHHHHHccTTcTTTHHHHHHHTcTTGGGTccccHHHHHHHHHHccccccHHHHHHHHHTcccccccccHHHHHccHHHHHHHHHHHHTTcccccccTTcHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHTHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHTTccccccc DISOP:02AL 1-1,182-185| PSIPRED cHHHHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccHHccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcc //