[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68393.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:47 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->42 PF11374 * DUF3176 0.00026 22.2 36/111  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68393.1 GT:GENE ACF68393.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1026257..1026400 GB:FROM 1026257 GB:TO 1026400 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF68393.1 GB:DB_XREF GI:194408174 LENGTH 47 SQ:AASEQ MQQCRYQALALNKNASRSGWHFASWMYTMRQRSYATASASMGTMTLA GT:EXON 1|1-47:0| HM:PFM:NREP 1 HM:PFM:REP 7->42|PF11374|0.00026|22.2|36/111|DUF3176| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccEEEEEEcccccccccHHHHHHHHHHHHHHHHccccccEEEEc //