[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68421.1
DDBJ      :             FAA-hydrolase-family protein
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  582/915 : Eukaryota  179/199 : Viruses  0/175   --->[See Alignment]
d.177.1
:233 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   26->232 1sawB PDBj 7e-33 40.4 %
:RPS:PDB   5->233 2dfuA PDBj 6e-49 31.7 %
:RPS:SCOP  26->233 1gttA1  d.177.1.1 * 2e-50 26.2 %
:HMM:SCOP  9->233 1nr9A_ d.177.1.1 * 4e-64 38.2 %
:RPS:PFM   29->233 PF01557 * FAA_hydrolase 3e-25 39.2 %
:HMM:PFM   27->231 PF01557 * FAA_hydrolase 1.1e-50 37.7 199/217  
:BLT:SWISS 26->225 FAHD1_DICDI 9e-38 39.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68421.1 GT:GENE ACF68421.1 GT:PRODUCT FAA-hydrolase-family protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2321220..2321921) GB:FROM 2321220 GB:TO 2321921 GB:DIRECTION - GB:PRODUCT FAA-hydrolase-family protein GB:NOTE identified by match to protein family HMM PF01557 GB:PROTEIN_ID ACF68421.1 GB:DB_XREF GI:194408202 LENGTH 233 SQ:AASEQ MTKYVFQPQAPVTVPVAGSDEQFPVRRVYCVGRNYAAHAREMGFDPDREPPFFFCKPADAVVPVAAGDTLELPYPAQTDNYHYEIELVVAIGKKGSDIPLEKAHEYVWGYATGLDMTRRDRQMEMRQMGRPWEIGKAFDLSAPIAPLHKAAETHNVDNAPIWLQVNGEDHQRSDIRHLIWSVNETISYLSGFFELQPGDLIFTGTPEGVGAVVKGDVITGNVEGLTPIAVKIV GT:EXON 1|1-233:0| BL:SWS:NREP 1 BL:SWS:REP 26->225|FAHD1_DICDI|9e-38|39.3|196/218| SEG 57->66|padavvpvaa| BL:PDB:NREP 1 BL:PDB:REP 26->232|1sawB|7e-33|40.4|188/208| RP:PDB:NREP 1 RP:PDB:REP 5->233|2dfuA|6e-49|31.7|218/251| RP:PFM:NREP 1 RP:PFM:REP 29->233|PF01557|3e-25|39.2|199/213|FAA_hydrolase| HM:PFM:NREP 1 HM:PFM:REP 27->231|PF01557|1.1e-50|37.7|199/217|FAA_hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01557|IPR002529| GO:PFM GO:0008152|"GO:metabolic process"|PF01557|IPR002529| RP:SCP:NREP 1 RP:SCP:REP 26->233|1gttA1|2e-50|26.2|195/213|d.177.1.1| HM:SCP:REP 9->233|1nr9A_|4e-64|38.2|220/221|d.177.1.1|1/1|FAH| OP:NHOMO 1753 OP:NHOMOORG 817 OP:PATTERN 11---11211111121-112111221122143-1111111111-----111111111-1111211-11 2221421222221252111-11112311111121212178121323211222665122--113122424211111111----4-11--11111111---11221221212---------------11-11111-111-12211113-111111----------1111111--------1----2222211-31122222222322322233111122213312111111113311111111111111111111-----------11--11-----------------------------------------------------12--1-----------211---------2---1331---1-1112111--1-16111-1--1329671124334233333332332-32623524722-533723333222745313643233245--------221-2312-----------------------------2-2G1-7762678A6752444277754444-464G3A56-4333323225672B4331----111111111---221121--1-1-21111111111111-111112-11--11---1---1---------11111--11111-1111111111-111111--111----11-------32221211221111122-2212111211212221223222222214242434444434324522122221-122233323333---1---------11124--------------111111111121233434326123211122111111111-111111111111121122222222-------1----11--------------------------------------1--------11 ----222-21--1113442645397772222222223333233222434975DB3454333321311111111131111112222211-32142223222212211-131424212-11--12-221217F4-32311113-2311-1--2-1212213322134423233112211117111-122322221222221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 229 STR:RPRED 98.3 SQ:SECSTR ####TTccEEEEEEEGGGccEEcccccEEEEcccccccccccEEEEcGGGEEcccccTTccTTcHHHHcccEEEccccccEEccEEEEEEEccccccccHHHHGGGEEEEEEEEccEEHHHHHHcccHccccHHHHccTTcEEEEEEEEccccccTTccEEEEEETTEEEEEEEGGGccccHHHHHHHHHTTccccTTcEEEcccccccccccTTcEEEEEETTTEEEEEEEE PSIPRED ccccccccccccEEccccccccccccEEEEEEccHHHHHHHcccccccccEEEEEcccccEEEcccccccccEEccccccccEEEEEEEEEccccccccHHHHHHHccEEEEEEEEEHHHcccHHHHcccccccccccccccccccEEEHHHcccHHccEEEEEEccEEEEEccHHHccccHHHHHHHHHccEEEccccEEEEcccccccccccccEEEEEEccEEEEEEEEc //