[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68438.1
DDBJ      :             EaC
Swiss-Prot:VEAC_BPP22   RecName: Full=Eac protein;

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:100 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->100 VEAC_BPP22 5e-49 98.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68438.1 GT:GENE ACF68438.1 GT:PRODUCT EaC GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(378243..378545) GB:FROM 378243 GB:TO 378545 GB:DIRECTION - GB:PRODUCT EaC GB:PROTEIN_ID ACF68438.1 GB:DB_XREF GI:194408219 LENGTH 100 SQ:AASEQ MHNANAKLKSLPEWNYYITNHYGIMRTGIGGQSGRGFGFVMLSTYGGKHPQRDDCLIFAIPNNKEERHGVVVIPDAFKKITYGQFYDIANAKEDEEETAE GT:EXON 1|1-100:0| SW:ID VEAC_BPP22 SW:DE RecName: Full=Eac protein; SW:GN Name=eac; SW:KW SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->100|VEAC_BPP22|5e-49|98.0|100/100| SEG 28->38|giggqsgrgfg| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------1-----1------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,89-101| PSIPRED cccccccHHccccccEEEEEEEEEEEEcccccccccEEEEEEEEccccccccccEEEEEEccccHHHccEEEcccccccccccEEEEcccccccHHHHcc //