[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68447.1
DDBJ      :             protein AraJ
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  441/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.5f.38.1
:390 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   42->182 2d33D PDBj 2e-05 9.2 %
:RPS:SCOP  5->44 1fzpB  a.4.5.28 * 6e-04 15.0 %
:RPS:SCOP  29->235 1pv6A  f.38.1.2 * 1e-08 19.8 %
:HMM:SCOP  1->383 1pw4A_ f.38.1.1 * 4.5e-48 24.2 %
:RPS:PFM   8->282 PF07690 * MFS_1 6e-15 22.9 %
:HMM:PFM   8->329 PF07690 * MFS_1 5.9e-39 22.1 321/353  
:BLT:SWISS 1->388 ARAJ_ECOLI e-167 85.1 %
:TM
:REPEAT 2|8->85|94->175
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68447.1 GT:GENE ACF68447.1 GT:PRODUCT protein AraJ GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(492031..493203) GB:FROM 492031 GB:TO 493203 GB:DIRECTION - GB:PRODUCT protein AraJ GB:NOTE identified by match to protein family HMM PF07690 GB:PROTEIN_ID ACF68447.1 GB:DB_XREF GI:194408228 LENGTH 390 SQ:AASEQ MKKVIFSLALGTFGLGMAEFGIMGVLTELARDVGITIPAAGHMISFYAFGVVLGAPVMALFSSRFSLKHILLFLVMLCVMGNAIFTFSSSYLMLAVGRLVSGFPHGAFFGVGAIVLSKIIRPGKVTAAVAGMVSGMTVANLVGIPVGTYLSQEFSWRYTFLLIAVFNIAVLTAIFFWVPDIHDKAQGSLREQFHFLRSPAPWLIFAATMFGNAGVFAWFSYIKPFMMYISGFSETSMTFIMMLVGLGMVLGNLLSGKLSGRYTPLRIAVVTDLVIVLSLMALFFFSGYKTTSLTFAFICCAGLFALSAPLQILLLQNAKGGELLGAAGGQIAFNLGSAIGAWCGGLMLTLGFAYHYVALPAALLSFSAMSSLLVYGRLKHKQPSVTPVAG GT:EXON 1|1-390:0| BL:SWS:NREP 1 BL:SWS:REP 1->388|ARAJ_ECOLI|e-167|85.1|388/394| TM:NTM 11 TM:REGION 22->44| TM:REGION 74->96| TM:REGION 102->124| TM:REGION 127->149| TM:REGION 158->180| TM:REGION 203->225| TM:REGION 237->259| TM:REGION 264->285| TM:REGION 294->316| TM:REGION 325->347| TM:REGION 356->377| NREPEAT 1 REPEAT 2|8->85|94->175| SEG 241->254|mmlvglgmvlgnll| SEG 320->329|ggellgaagg| SEG 358->373|alpaallsfsamssll| RP:PDB:NREP 1 RP:PDB:REP 42->182|2d33D|2e-05|9.2|141/499| RP:PFM:NREP 1 RP:PFM:REP 8->282|PF07690|6e-15|22.9|275/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 8->329|PF07690|5.9e-39|22.1|321/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 2 RP:SCP:REP 5->44|1fzpB|6e-04|15.0|40/105|a.4.5.28| RP:SCP:REP 29->235|1pv6A|1e-08|19.8|202/417|f.38.1.2| HM:SCP:REP 1->383|1pw4A_|4.5e-48|24.2|380/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 1131 OP:NHOMOORG 447 OP:PATTERN --------------------------------------1----------------------------- -----1112232132------1--12-----11---3733----1145111-34411311--1-225244-1111211--2------1--21-1-------3-113--11-----------------------------------------------------------------------------------6333333231242234213354224--1221211111-C6222232121122211323231-3-21-2---1133111-1--3111-----------------------------------------------------------1-------------------------------------4----11-13-51----1-1-1----------4-1121111116--44422216333452-1--21------12222222212331--2--------------------------------1-23322568A6873222266562223236735562--443-2311311-4213--1-131-1---------2-3-------111---11-1----------1---11---12121-121111111-------111211-2-2112112-22311---11111-------------3413-934554444444-4444444444545444442797341114244334333434343743344441-211111111111---------1111---16111-11-22-2---133333241115155343569255562867--1111-1--1--1-----1-2--56332331111------122111-------------------------------------------1------ ---------------------------------------------------------------------------------------------------------1----------------------------------------------------------------A-----------------1-----1-1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 36.2 SQ:SECSTR #########################################EcTTcEEEcTTcccGGGcTTcccccTTccccccHHHHHHHHHHHHHcccHHHHTTccEETTEEccccccccccGGGccccEEEEccccTTccHHHHHHHHcccEEEEEEEccTTcTTcccHHHHHHHHHHHHHHHHccccc################################################################################################################################################################################################################ DISOP:02AL 178-194,383-391| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //