[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68460.1
DDBJ      :             glycine betaine/L-proline transport system permease protein ProW
Swiss-Prot:PROW_SALTY   RecName: Full=Glycine betaine/L-proline transport system permease protein proW;

Homologs  Archaea  21/68 : Bacteria  579/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:354 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   148->273 3dhwA PDBj 2e-11 32.5 %
:RPS:PDB   232->271 3dhwA PDBj 1e-16 45.0 %
:RPS:SCOP  142->298 2r6gG1  f.58.1.1 * 3e-17 17.2 %
:RPS:PFM   161->295 PF00528 * BPD_transp_1 4e-10 35.6 %
:HMM:PFM   163->324 PF00528 * BPD_transp_1 1.1e-28 28.4 162/185  
:BLT:SWISS 1->354 PROW_SALTY e-171 99.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68460.1 GT:GENE ACF68460.1 GT:PRODUCT glycine betaine/L-proline transport system permease protein ProW GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2931657..2932721 GB:FROM 2931657 GB:TO 2932721 GB:DIRECTION + GB:PRODUCT glycine betaine/L-proline transport system permease protein ProW GB:NOTE identified by match to protein family HMM PF00528 GB:PROTEIN_ID ACF68460.1 GB:DB_XREF GI:194408241 LENGTH 354 SQ:AASEQ MADQTNPWDTAQVADTTTQTADAWGTPAGVATDGGSTDWLNSAPAPAPEHFSLLDPFHKTLIPLDSWVTEGIDWVVTHFRPLFQGIRVPVDYILNGFQQLLLGMPAPVAIILFALIAWQVSGVGMGIATLISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLARSPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSRSRGNRRWYTTGPVGLITRPFVK GT:EXON 1|1-354:0| SW:ID PROW_SALTY SW:DE RecName: Full=Glycine betaine/L-proline transport system permease protein proW; SW:GN Name=proW; OrderedLocusNames=STM2810; SW:KW Amino-acid transport; Cell inner membrane; Cell membrane;Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->354|PROW_SALTY|e-171|99.7|354/354| GO:SWS:NREP 6 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 6 TM:REGION 99->121| TM:REGION 123->145| TM:REGION 149->171| TM:REGION 201->223| TM:REGION 263->285| TM:REGION 303->325| SEG 9->23|dtaqvadtttqtada| SEG 126->141|giatlisliaigaiga| SEG 304->320|glatvggvgivilaiil| BL:PDB:NREP 1 BL:PDB:REP 148->273|3dhwA|2e-11|32.5|126/203| RP:PDB:NREP 1 RP:PDB:REP 232->271|3dhwA|1e-16|45.0|40/203| RP:PFM:NREP 1 RP:PFM:REP 161->295|PF00528|4e-10|35.6|135/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 163->324|PF00528|1.1e-28|28.4|162/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 142->298|2r6gG1|3e-17|17.2|157/284|f.58.1.1| OP:NHOMO 1738 OP:NHOMOORG 602 OP:PATTERN -----------------------1--------2--211212122221--31131------2-----1- 1-1-211---1-3-411----3--37-----313336563-2---11-11125-2222--54-125485631-------12-4-----1121-2-----------1-11----------------1----------11131---21212222-11222---1-31-232-111-----1----11------1-53333334423433344-4445333111242133333336332222222222322344433-31341-1-133--444-212-111444221214411111111111222222222222221122-1112-1248111122121113771221131--2----54131123152111-11---2----1--11167D1125324244434344447-336227145511DBB875BB79AA94--131A533431511111111211-21-4-----------------------------2--1--3764128877554442445444442494B5657-13221-31111848A-2--2--52-------11--12123233111-3112-14--1-2--112-34-2-11------------------------311---1---4-1111-11------1--11--1121-------66311515445555555-4555555545455555556454321124434444444444444555455552-244444424444----11111------451----11---------11111---112255555677466551755----------12241111133422--21111111-------3------11111111------------------------------1-----1---- -------------1-----------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 39.8 SQ:SECSTR #############################################################################################################################################HHHHHHHHHHHHHHHHHHHHTTGGGGGGGcccccHHHHHHHHHHHHHHccHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHTTc######################################################################## DISOP:02AL 1-5,13-33| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcc //