[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68482.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  295/915 : Eukaryota  78/199 : Viruses  0/175   --->[See Alignment]
e.56.1
:246 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->231 1xqbA PDBj 1e-36 48.2 %
:RPS:SCOP  13->233 1xqbA  e.56.1.1 * 8e-56 45.3 %
:HMM:SCOP  12->242 1xqbA_ e.56.1.1 * 3.6e-84 51.1 %
:RPS:PFM   31->152 PF01980 * UPF0066 9e-34 62.9 %
:HMM:PFM   29->153 PF01980 * UPF0066 2.3e-42 57.6 118/120  
:HMM:PFM   189->225 PF11663 * Toxin_YhaV 0.00017 27.0 37/141  
:BLT:SWISS 12->246 YAEB_ECOLI e-112 88.5 %
:PROS 98->109|PS01318|UPF0066
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68482.1 GT:GENE ACF68482.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(292025..292765) GB:FROM 292025 GB:TO 292765 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF01980; match to protein family HMM TIGR00104 GB:PROTEIN_ID ACF68482.1 GB:DB_XREF GI:194408263 LENGTH 246 SQ:AASEQ MYRVRPEYFGEMSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSACGELHLIAPYNQADAVRGLEAFSHLWVLFVFHQTMDGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSLVALKGIECRKESVILKLGSLDLVDGTPVVDIKPYLPFAEALPDAAASYAQQAPIAEMPVSFTAEVAQQLTTLERRYPQLRTFICDVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRVVNTGFEVFALEPR GT:EXON 1|1-246:0| BL:SWS:NREP 1 BL:SWS:REP 12->246|YAEB_ECOLI|e-112|88.5|235/235| PROS 98->109|PS01318|UPF0066|PDOC01022| SEG 155->170|alpdaaasyaqqapia| BL:PDB:NREP 1 BL:PDB:REP 20->231|1xqbA|1e-36|48.2|168/183| RP:PFM:NREP 1 RP:PFM:REP 31->152|PF01980|9e-34|62.9|116/120|UPF0066| HM:PFM:NREP 2 HM:PFM:REP 29->153|PF01980|2.3e-42|57.6|118/120|UPF0066| HM:PFM:REP 189->225|PF11663|0.00017|27.0|37/141|Toxin_YhaV| RP:SCP:NREP 1 RP:SCP:REP 13->233|1xqbA|8e-56|45.3|179/186|e.56.1.1| HM:SCP:REP 12->242|1xqbA_|3.6e-84|51.1|231/0|e.56.1.1|1/1|YaeB-like| OP:NHOMO 485 OP:NHOMOORG 403 OP:PATTERN 111--111-------1--22-222-----1--1-1-----21-123621-11-11---1-1---1--- -11-2-----------------------------------------------------------------------------------------------------------------------1--------1-------111-11-----------------------------------------11----1111111111111111-11--1-1--1------------------------------------------------------------------------------------------------------1----111-111-1--1------------11--342--1----1111----1--11------1-11122111111------------11111111-1--1-------11--1--1----------1------------1-1-------------------------------------------------------------1-----------------1-------1----111111111------31112211-21--1-1111-1-22-----121---------------------------111111111111111111211111111111----11-------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---------------1111111111111111111111-111111111111111111111111----------11111111111111-----------------------------------------------------------------1-111--1 ---2221-1-1-------------------------------------------------------------------------------------------------7411111121111-1121-315A1-21411--111111111111-1----1---121-12112---11-114212111111-111212123 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 187 STR:RPRED 76.0 SQ:SECSTR ###################cEEEEcccccGGGccccTTTcTTcEEEEEEcTTTccTTTTTTGGGccEEEEEEETTcccc###ccEEccT##TcccEccGGGcccccccccEEEEEEEEEEEEEETTEEEEEEEEccccTTcEEEEEEEccHHHH#######ccTTccccccccEEEcHHHHHHHHHHTTTcTTTTTTcccTTcc#############cccEEEETTEEEEc############### DISOP:02AL 1-7,161-163| PSIPRED cEEccccccccEEEEEEEEEEEEEcccccccccccccccccccEEEEEEEcccccHHHHHHHHcccEEEEEEEEEccccccccEEEEcccccccEEEEEEEEccccccccEEEEEEEEEEEEccccccEEEEEEEEccccccEEEEEccccccccccccccccccccccccEEEEEcHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHcccccccEEEEEEEEEEEEEEEccccEEEEEEEEc //