[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68486.1
DDBJ      :             ATP-binding protein of ABC transport system
Swiss-Prot:             

Homologs  Archaea  61/68 : Bacteria  851/915 : Eukaryota  116/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:196 amino acids
:PSIPRED
:BLT:PDB   18->187 2ixfC PDBj 5e-15 33.5 %
:RPS:PDB   2->191 3dmdC PDBj 6e-27 10.4 %
:RPS:SCOP  1->188 1sgwA  c.37.1.12 * 8e-31 20.9 %
:HMM:SCOP  1->196 1g6hA_ c.37.1.12 * 1.4e-36 28.1 %
:RPS:PFM   41->150 PF00005 * ABC_tran 3e-09 40.6 %
:HMM:PFM   41->150 PF00005 * ABC_tran 6.8e-12 29.0 107/118  
:HMM:PFM   121->187 PF02463 * SMC_N 2.2e-05 29.2 65/220  
:HMM:PFM   20->51 PF00006 * ATP-synt_ab 0.00036 28.1 32/215  
:BLT:SWISS 5->43 CFTR_RAT 2e-04 41.0 %
:BLT:SWISS 18->188 Y4TS_RHISN 4e-20 32.2 %
:PROS 122->136|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68486.1 GT:GENE ACF68486.1 GT:PRODUCT ATP-binding protein of ABC transport system GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1348359..1348949 GB:FROM 1348359 GB:TO 1348949 GB:DIRECTION + GB:PRODUCT ATP-binding protein of ABC transport system GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF68486.1 GB:DB_XREF GI:194408267 LENGTH 196 SQ:AASEQ MLSCRDLVIRQGGKVLWQNLTFTISAGERVGIHAPSGTGKTTLGRVLAGWQKPTAGDVLLDGSPLPLHQYCPVQLVPQHPELTFNPWRSAGDAVRDAWQPDPETMRRLHVQPEWLTRRPMQLSGGELARIAILRALDPRTRFLIADEMTAQLDPSIQKAIWGYVLEVCRSRSLGMLVISHQSALLDQVCTRHLQVE GT:EXON 1|1-196:0| BL:SWS:NREP 2 BL:SWS:REP 5->43|CFTR_RAT|2e-04|41.0|39/1476| BL:SWS:REP 18->188|Y4TS_RHISN|4e-20|32.2|171/353| PROS 122->136|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 18->187|2ixfC|5e-15|33.5|170/252| RP:PDB:NREP 1 RP:PDB:REP 2->191|3dmdC|6e-27|10.4|182/318| RP:PFM:NREP 1 RP:PFM:REP 41->150|PF00005|3e-09|40.6|106/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 41->150|PF00005|6.8e-12|29.0|107/118|ABC_tran| HM:PFM:REP 121->187|PF02463|2.2e-05|29.2|65/220|SMC_N| HM:PFM:REP 20->51|PF00006|0.00036|28.1|32/215|ATP-synt_ab| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->188|1sgwA|8e-31|20.9|187/200|c.37.1.12| HM:SCP:REP 1->196|1g6hA_|1.4e-36|28.1|192/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 8381 OP:NHOMOORG 1028 OP:PATTERN 664-665276566565D536441465578463253242-2--14532A45IG96857623474-8--2 6637I19488943289C44-4A119G4444457ABA4MFL4F5G7FC9A975EGH445119836B9DICK87444G8B56B4621133---1-1117----1--111112144444434244445244434755845BBBA224DB8788775AB99423352657AEAA414332123121132532AA175ACCDCDEDHBDECDEEIBAACCFCD95AI886333434SL3777777577777775332252788893515A9119B8654244654557AA936678875787778767766867666855567755584C27533354554245355233284426F4675PN992-7B566894264115622252442B5iUe56EO9GO8HHGHIHKDGGl-A9PA8MANYl61*ccobZUurjldaB362HNaMFONISI656666667666686I111--1111211--11-------------223423QSNDKHLLKLL9CCCAJKQPEEDE8ELIcGCKF14CD99CDCBAAQHVl4C64846954454344533796B6G3A6CB6677664535683551453599391332132323-332222222-713411DE93I42433B72232336222332444731-15285------EHWUBLKJIIIJIIIHI-IIIHIIIIIIIIJIIIIIERZUPR75AEGEEFFFGEGFDFDEFRIIGHGEH8-JEEFHFFEEHHH--4511--1565644OBC778577645549777666563335AG68988AFBIBFDBD9IJK1-1-1111-44CBCDEDDEACCBC3232222232----114211332211111-1-912--11--11223-122112-42----65A84DFEAC165 ----1-1--------1---1---1-----21112211232222-------11121-11-111-------------11--1-11----1-141-3-2----2-2----12-A13-13311212322216-9W72517342-21222343117--A13226--1-212-4234333-1--1Q-1---32261451247A5- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEEEEEccEEEEEcccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEccHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHcccHHccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHcccEEEEc //