[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68493.1
DDBJ      :             AraC-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  74/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.24.16a.4.1
:334 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   242->323 2k9sA PDBj 4e-04 25.6 %
:RPS:PDB   238->323 1bl0A PDBj 8e-17 16.3 %
:RPS:SCOP  236->323 1v4aA1  a.24.16.4 * 2e-14 11.4 %
:HMM:SCOP  223->274 1d5yA1 a.4.1.8 * 3.8e-08 34.6 %
:HMM:SCOP  277->325 1d5yA2 a.4.1.8 * 2.4e-10 32.7 %
:HMM:PFM   238->274 PF00165 * HTH_AraC 5.1e-06 22.2 36/42  
:HMM:PFM   290->323 PF00165 * HTH_AraC 2.3e-06 24.2 33/42  
:HMM:PFM   72->112 PF07883 * Cupin_2 8.9e-05 34.1 41/71  
:HMM:PFM   194->243 PF02565 * RecO_C 0.00028 42.4 33/118  
:BLT:SWISS 85->323 PCHR_PSEAE 2e-12 31.3 %
:PROS 278->319|PS00041|HTH_ARAC_FAMILY_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68493.1 GT:GENE ACF68493.1 GT:PRODUCT AraC-family transcriptional regulator GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 458640..459644 GB:FROM 458640 GB:TO 459644 GB:DIRECTION + GB:PRODUCT AraC-family transcriptional regulator GB:NOTE identified by match to protein family HMM PF00165 GB:PROTEIN_ID ACF68493.1 GB:DB_XREF GI:194408274 LENGTH 334 SQ:AASEQ MSPISCHSSAAPAMKKIFSVSDFIAFGERYGIDYRFPALPQYTQSSPVLHGDIEEIALPGGICITRSDVHVLQPYETTSRHSSPLYMLVVLEGNVALAVNEQTFLLSAGMAFCSQLSEQQTIRAHHGADSKLRTLSLGMYPDGGWRERLPVSLADEWENSATSARVWQVPEFLLSGLRYAQQPGPHAASRQLMLEGIMLQLLGYALNLCQPATQKRGLPVTGEYQRLELIRRLLEQTPEKAYTLNELARRAAMSPSSLRCKFRHAYGCTVFDYLRDCRLARARRYLMEGYSVQQAAWMSGYQHATNFATAFRRRYGCSPGELRDASLTASRHCA GT:EXON 1|1-334:0| BL:SWS:NREP 1 BL:SWS:REP 85->323|PCHR_PSEAE|2e-12|31.3|227/296| PROS 278->319|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| SEG 226->235|rlelirrlle| BL:PDB:NREP 1 BL:PDB:REP 242->323|2k9sA|4e-04|25.6|82/107| RP:PDB:NREP 1 RP:PDB:REP 238->323|1bl0A|8e-17|16.3|86/116| HM:PFM:NREP 4 HM:PFM:REP 238->274|PF00165|5.1e-06|22.2|36/42|HTH_AraC| HM:PFM:REP 290->323|PF00165|2.3e-06|24.2|33/42|HTH_AraC| HM:PFM:REP 72->112|PF07883|8.9e-05|34.1|41/71|Cupin_2| HM:PFM:REP 194->243|PF02565|0.00028|42.4|33/118|RecO_C| RP:SCP:NREP 1 RP:SCP:REP 236->323|1v4aA1|2e-14|11.4|88/151|a.24.16.4| HM:SCP:REP 223->274|1d5yA1|3.8e-08|34.6|52/54|a.4.1.8|1/2|Homeodomain-like| HM:SCP:REP 277->325|1d5yA2|2.4e-10|32.7|49/0|a.4.1.8|2/2|Homeodomain-like| OP:NHOMO 99 OP:NHOMOORG 76 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------1---1-2-1------------------------1-----------3----------------1--2-7-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1------------------111----------------2--------------------1-2--------------------------------2---11121----2-------1-1111-11-4------------112---1---------------------------------1-----1-----1------1-------------------------------------------------------1------------------2--1----------------------------------22---1--1111111111111----------1--------------------------11--------------------------1-1111-1-------111----------------------1--12----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 86 STR:RPRED 25.7 SQ:SECSTR #############################################################################################################################################################################################################################################TTcccccHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccHHHHH########### DISOP:02AL 1-8,211-224,324-335| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHccEEEEEcccccccccccEEEEEEEEEEEcccEEEEEEEEEcccccccEEEEcccEEEEEEEEcEEEEEEccEEEEEccccEEEEcccccEEEEEEccccccEEEEEEEEEccHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHcccccccc //