[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68522.1
DDBJ      :             protein bdm
Swiss-Prot:BDM_SALTY    RecName: Full=Protein bdm homolog;

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->71 PF10684 * BDM 8e-27 90.1 %
:HMM:PFM   1->71 PF10684 * BDM 1e-45 90.1 71/92  
:BLT:SWISS 1->71 BDM_SALTY 5e-37 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68522.1 GT:GENE ACF68522.1 GT:PRODUCT protein bdm GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1694031..1694246 GB:FROM 1694031 GB:TO 1694246 GB:DIRECTION + GB:PRODUCT protein bdm GB:PROTEIN_ID ACF68522.1 GB:DB_XREF GI:194408303 LENGTH 71 SQ:AASEQ MFTYHSANTSAAQPALVNAIEQGLRAELGVVTEDDILMELTKWVEASDNDILSDIYQQTINYVVSGQHPTL GT:EXON 1|1-71:0| SW:ID BDM_SALTY SW:DE RecName: Full=Protein bdm homolog; SW:GN Name=bdm; OrderedLocusNames=STM1564; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->71|BDM_SALTY|5e-37|100.0|71/71| RP:PFM:NREP 1 RP:PFM:REP 1->71|PF10684|8e-27|90.1|71/71|BDM| HM:PFM:NREP 1 HM:PFM:REP 1->71|PF10684|1e-45|90.1|71/92|BDM| OP:NHOMO 48 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111111111-1111111111111111111--------1111111111111111-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,5-7,70-72| PSIPRED ccEEEEccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccc //