[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68558.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  34/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:573 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   259->472 PF10592 * AIPR 8e-23 37.2 %
:HMM:PFM   259->537 PF10592 * AIPR 1.2e-54 30.1 266/301  
:HMM:PFM   519->559 PF03513 * Cloacin_immun 0.00027 26.8 41/82  
:BLT:SWISS 213->383 GLMU_NITOC 6e-04 30.7 %
:BLT:SWISS 327->419 SYE_ELUMP 3e-04 27.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68558.1 GT:GENE ACF68558.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2552025..2553746) GB:FROM 2552025 GB:TO 2553746 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF68558.1 GB:DB_XREF GI:194408339 LENGTH 573 SQ:AASEQ MHAILSQYIEDLSHEFDIQNESESKLFEYFCNYVITSKYFLGRFNPMDITTQEDDASLDGIAIIIDGELIISVDDAMTAFDTYKTSLPVDIIITQAKSGESFSKDDISNFNLGLQDFFSLEPKLPNGIYNGQAIEIIKVIVANVKKIKNKMPNLKVFFCTSGVYNNEREIAASFKILNKTCENADIFNDIEVFPMGRKELMKLWSSISDKNEASIQLIDYIGINEMPGIPQAYISIVKAKEFLEKIAMDDEGNIREEVFDENVRAFLGGDNPVNKDIAKTLHSEKSKQFAVLNNGVTIIAPEIAIQSNTKVMHLTNYQIINGCQTTNTLYEHYADLNDNVELVVKFIESQDTDVAIEIVTATNNQSAVENEAFYALREKARLIQKFFDIQRNDEAKEKLFFERRENEYRNKSIQTTKIYDIKELARCFISVFKLRPHDASRYVKKVLNTSDIVFDDKDNECAYHCAAYICYKFNTLINGRKNDAPKYNRLRWHIAMLYPWVVFGKVETPDPSSKKITAYCDKVLKTLLNEEYIENFKTCQRIIDSIEMPTDDQIKRGKYTSELKEAAEKFLNK GT:EXON 1|1-573:0| BL:SWS:NREP 2 BL:SWS:REP 213->383|GLMU_NITOC|6e-04|30.7|153/100| BL:SWS:REP 327->419|SYE_ELUMP|3e-04|27.8|90/488| SEG 58->71|ldgiaiiidgelii| SEG 133->150|aieiikvivanvkkiknk| RP:PFM:NREP 1 RP:PFM:REP 259->472|PF10592|8e-23|37.2|207/295|AIPR| HM:PFM:NREP 2 HM:PFM:REP 259->537|PF10592|1.2e-54|30.1|266/301|AIPR| HM:PFM:REP 519->559|PF03513|0.00027|26.8|41/82|Cloacin_immun| OP:NHOMO 41 OP:NHOMOORG 37 OP:PATTERN --------------------------------------1----------------------------1 ----------------------------------------------------------------------------------------------------1--------1------------------------------------1----------------11-11--1---------------------------------------------------1------------------------------------------------------------------------------------------------------------1----------------1-------11--------------1-----------------------------------1----------------1----1----------------------------------------------------------------------1------------------------1---------------------------2-11-------1-1---------1--2-----------1----------------------------------1------------------2-------------------------------------------------------------------------------1-1-1------------------------------------------------------------------1----------------------------------------------------------------------------1---------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,573-574| PSIPRED cHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEccEEEccHHHHHHcccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccccccEEEEccHHHHHHHHHHHccccccEEEccccEEEcccccccEEEEEEEEHHHHHHHHcccccccccccccHHHHHHHHccccHHHHHHHHHHHcccccccEEEEccEEEEEcccccccccEEEEEEccEEEcccHHHHHHHHHHcccccEEEEEEEEEccccHHHHHHHHHHHcccccccHHHHHHccHHHHHHHHHHHHcccccccccEEEccccccccccccccEEEEcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcc //