[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68567.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  69/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:222 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   33->221 PF06226 * DUF1007 4e-40 47.3 %
:HMM:PFM   18->221 PF06226 * DUF1007 8.6e-69 38.6 202/213  
:BLT:SWISS 33->222 Y1249_HAEIN 2e-31 36.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68567.1 GT:GENE ACF68567.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2746998..2747666) GB:FROM 2746998 GB:TO 2747666 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF06226 GB:PROTEIN_ID ACF68567.1 GB:DB_XREF GI:194408348 LENGTH 222 SQ:AASEQ MSQNFYREEQMKPVKRSALTLFLAVLSFVAAAHPHSFIRLQTQVVSENEQFVALKMRWTMDALTSADLLYDAGNAAPGSEIWKKLAAEVMANVLGQHYFTEVWRNGAKVKFKNRPTEYGMTRDAHQAVLTFTLPLAEPQPLSGQTYTFSTFDPSYYVDMHYDQDSDITMPEPLREKCRIQVYTPAPGEETLRFAQSLDKEDAPPEDMDLGKQFAQTVTLQCQ GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 33->222|Y1249_HAEIN|2e-31|36.9|187/100| TM:NTM 1 TM:REGION 17->36| SEG 17->32|saltlflavlsfvaaa| RP:PFM:NREP 1 RP:PFM:REP 33->221|PF06226|4e-40|47.3|186/208|DUF1007| HM:PFM:NREP 1 HM:PFM:REP 18->221|PF06226|8.6e-69|38.6|202/213|DUF1007| OP:NHOMO 69 OP:NHOMOORG 69 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---------------------------11-1--1--1---111-----------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1111-11------------------------------11111--111111111111111111-------1-111111111111----------------1-111-1-1111-1111---------------------------------------1--1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEccEEEEEEEEEEEcccHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccEEEEEEccEEEEEEccccEEEEEEEccEEEEEEEEcccccccccccEEEEEEEcccEEEEEEEcccccEEEccccccccEEEEEEccccHHHHHHHHHcccccccccccccccccccEEEEEEc //