[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68571.1
DDBJ      :             putative lysine-arginine-ornithine-binding periplasmic protein
Swiss-Prot:HISJ_SALTY   RecName: Full=Histidine-binding periplasmic protein;         Short=HBP;Flags: Precursor;

Homologs  Archaea  28/68 : Bacteria  658/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:260 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   24->260 1hslA PDBj e-136 100.0 %
:RPS:PDB   26->257 3delB PDBj 4e-44 27.1 %
:RPS:SCOP  25->260 1hslA  c.94.1.1 * 5e-52 100.0 %
:HMM:SCOP  1->258 2a5sA1 c.94.1.1 * 6e-66 39.5 %
:RPS:PFM   36->254 PF00497 * SBP_bac_3 2e-34 37.7 %
:HMM:PFM   28->254 PF00497 * SBP_bac_3 1.9e-68 37.7 220/225  
:BLT:SWISS 24->260 HISJ_SALTY e-135 100.0 %
:PROS 50->63|PS01039|SBP_BACTERIAL_3
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68571.1 GT:GENE ACF68571.1 GT:PRODUCT putative lysine-arginine-ornithine-binding periplasmic protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2509261..2510043) GB:FROM 2509261 GB:TO 2510043 GB:DIRECTION - GB:PRODUCT putative lysine-arginine-ornithine-binding periplasmic protein GB:NOTE identified by match to protein family HMM PF00497; match to protein family HMM TIGR01096 GB:PROTEIN_ID ACF68571.1 GB:DB_XREF GI:194408352 LENGTH 260 SQ:AASEQ MKKLALSLSLVLAFSSATAAFAAIPQKIRIGTDPTYAPFESKNAQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPAVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG GT:EXON 1|1-260:0| SW:ID HISJ_SALTY SW:DE RecName: Full=Histidine-binding periplasmic protein; Short=HBP;Flags: Precursor; SW:GN Name=hisJ; OrderedLocusNames=STM2354; SW:KW 3D-structure; Amino-acid transport; Complete proteome;Direct protein sequencing; Disulfide bond; Periplasm; Signal;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 24->260|HISJ_SALTY|e-135|100.0|237/260| GO:SWS:NREP 3 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0042597|"GO:periplasmic space"|Periplasm| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 50->63|PS01039|SBP_BACTERIAL_3|PDOC00798| TM:NTM 1 TM:REGION 4->26| SEG 4->23|lalslslvlafssataafaa| BL:PDB:NREP 1 BL:PDB:REP 24->260|1hslA|e-136|100.0|237/238| RP:PDB:NREP 1 RP:PDB:REP 26->257|3delB|4e-44|27.1|225/232| RP:PFM:NREP 1 RP:PFM:REP 36->254|PF00497|2e-34|37.7|212/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 28->254|PF00497|1.9e-68|37.7|220/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 25->260|1hslA|5e-52|100.0|236/239|c.94.1.1| HM:SCP:REP 1->258|2a5sA1|6e-66|39.5|253/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 3092 OP:NHOMOORG 689 OP:PATTERN 11---1----------1-2221112--11-1111----76883-2114----1----1---------- ----231---111121111-17--2A1111117777358912113111222-545212--111-63322316444433211-1--------------------------111111111111111-----1--4---11111111----24--12111-------1--224-------------2441111--263444437544553453232554452225444444443A422222222222222222221442687774346666773646832225556555365545756765565554455555555377B9977761355A453555523243332333-311122-3155-5121-111111228---111-1322322734111111116764637767J-118115-54C11LEEECBDFDGDEB5---12642342321111111122211-22---------------------------1-2-----49768KLLMMK78998GGHJ999979MFM3561--8693243254A89C--3----752222222----1-1172664944966632-23-3---11-11--4-5334332222111111111-22----566-2-----3-1111--11221121-11-2-2-1--------88FF4987776775777-7787777677777677669GHECB4439878899999999988C766767731878888887888--3-111116565--26522243322222222144444-4244--98798EBH668652877----------44465555544533-----------------7----------------3-------------------------121-113111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 237 STR:RPRED 91.2 SQ:SECSTR #######################cccEEEEEEccccTTTcEEcTTccEEcHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEcccccccHHHHTTEEEEEEEEEEEcEEEEEEEccccccccGGGcccEEEETTcHHHHHHHTHHHcTTccEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGcTTEEEEEEEcccEEcGGGcEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHHHHHTTGGGcETc PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccEEEEcccccEEEEHHHHHHHHHHHHccEEEEEEccHHHHHHHHHcccccEEEccccccHHHHHHHHccccEEEccEEEEEEccccccccHHHHcccEEEEEcccHHHHHHHHHccccccEEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHHccccccEEEccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccc //