[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68589.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:YBEL_ECOLI   RecName: Full=Uncharacterized protein ybeL;

Homologs  Archaea  0/68 : Bacteria  120/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:157 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->154 PF07295 * DUF1451 8e-49 71.7 %
:HMM:PFM   12->154 PF07295 * DUF1451 8.2e-56 45.5 143/146  
:BLT:SWISS 1->157 YBEL_ECOLI 2e-84 93.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68589.1 GT:GENE ACF68589.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 764982..765455 GB:FROM 764982 GB:TO 765455 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF07295 GB:PROTEIN_ID ACF68589.1 GB:DB_XREF GI:194408370 LENGTH 157 SQ:AASEQ MNKVAQYYRELVASLSERLRNGERDIDALVEQARQRVMQTGELTRTEVDELTRAVRRDLEEFAMSYEESQEDSVFLRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCEKCHYHLAVYTPDVLPLCPKCGHDQFQRRPFEP GT:EXON 1|1-157:0| SW:ID YBEL_ECOLI SW:DE RecName: Full=Uncharacterized protein ybeL; SW:GN Name=ybeL; OrderedLocusNames=b0643, JW0638; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->157|YBEL_ECOLI|2e-84|93.0|157/160| RP:PFM:NREP 1 RP:PFM:REP 10->154|PF07295|8e-49|71.7|145/147|DUF1451| HM:PFM:NREP 1 HM:PFM:REP 12->154|PF07295|8.2e-56|45.5|143/146|DUF1451| OP:NHOMO 121 OP:NHOMOORG 120 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---1--1-1111111111111111111---1111------11111111111111111-112111111111111111111111---1111111111111111111111111-111111111111------------------------------------------------------------------------11111111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,64-72,153-158| PSIPRED ccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccEEEccEEEEcccccEEEEEcccccccccccccccEEcccccc //