[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68590.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:YPEC_SHIFL   RecName: Full=Uncharacterized protein ypeC;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  70/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->85 PF10697 * DUF2502 5e-11 62.5 %
:HMM:PFM   6->106 PF10697 * DUF2502 1.8e-35 56.0 91/100  
:BLT:SWISS 1->91 YPEC_SHIFL 2e-43 95.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68590.1 GT:GENE ACF68590.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2581135..2581461 GB:FROM 2581135 GB:TO 2581461 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF68590.1 GB:DB_XREF GI:194408371 LENGTH 108 SQ:AASEQ MFRSLILAAALLAFTPLAANAGEITLLPSIKLQIGDRDDYGNYWDGGRWRDRDYWHNHYEWRKNRWWRHDNGYHRGWDKRKAYERGYREGWRDRDDHRGRGRGHKHHH GT:EXON 1|1-108:0| SW:ID YPEC_SHIFL SW:DE RecName: Full=Uncharacterized protein ypeC;Flags: Precursor; SW:GN Name=ypeC; OrderedLocusNames=SF2456, S2595; SW:KW Complete proteome; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->91|YPEC_SHIFL|2e-43|95.6|91/108| SEG 5->21|lilaaallaftplaana| SEG 92->107|rdrddhrgrgrghkhh| RP:PFM:NREP 1 RP:PFM:REP 22->85|PF10697|5e-11|62.5|64/107|DUF2502| HM:PFM:NREP 1 HM:PFM:REP 6->106|PF10697|1.8e-35|56.0|91/100|DUF2502| OP:NHOMO 72 OP:NHOMOORG 70 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21---1-111111111--111111111111111111211111---1111111111111111-11-1111--111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,96-109| PSIPRED ccHHHHHHHHHHHHHHHHHccccEEEccccEEEEcccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHcHHHcccccccHHHHHHHHcccccc //