[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68593.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:48 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->28 PF09738 * DUF2051 0.001 66.7 15/302  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68593.1 GT:GENE ACF68593.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2003779..2003925 GB:FROM 2003779 GB:TO 2003925 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF68593.1 GB:DB_XREF GI:194408374 LENGTH 48 SQ:AASEQ MVRKRGVIKPLLNEIRFKLLELQQKENDGLLMLDKLSKHGINGLIRRQ GT:EXON 1|1-48:0| HM:PFM:NREP 1 HM:PFM:REP 14->28|PF09738|0.001|66.7|15/302|DUF2051| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11-111-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,48-49| PSIPRED cccccccHHHHHHHHHHHHHHHHHHccccEEEHHHHHHcccHHHHccc //