[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68595.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.6.1
:130 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  7->53 1q1hA  a.4.5.41 * 2e-04 19.1 %
:HMM:SCOP  4->85 1tnsA_ a.6.1.7 * 3.8e-14 32.4 %
:RPS:PFM   8->129 PF07037 * DUF1323 4e-22 51.7 %
:HMM:PFM   8->128 PF07037 * DUF1323 3.5e-56 56.2 121/122  
:BLT:SWISS 8->129 YFED_ECOLI 6e-37 61.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68595.1 GT:GENE ACF68595.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2587520..2587912 GB:FROM 2587520 GB:TO 2587912 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF07037 GB:PROTEIN_ID ACF68595.1 GB:DB_XREF GI:194408376 LENGTH 130 SQ:AASEQ MKRLRSKMTTEELAECLGVARQTVNRWIREQHWKTEKFPGVKGGRARLIHIDASVREFILNIPAFRKLPAFYQAEEAFAEYANAAHSHAYRQIIDAVENMSAQEQEKLALFLSREGIRGFLTRLGINEAD GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 8->129|YFED_ECOLI|6e-37|61.5|122/123| SEG 70->90|afyqaeeafaeyanaahshay| RP:PFM:NREP 1 RP:PFM:REP 8->129|PF07037|4e-22|51.7|116/116|DUF1323| HM:PFM:NREP 1 HM:PFM:REP 8->128|PF07037|3.5e-56|56.2|121/122|DUF1323| RP:SCP:NREP 1 RP:SCP:REP 7->53|1q1hA|2e-04|19.1|47/85|a.4.5.41| HM:SCP:REP 4->85|1tnsA_|3.8e-14|32.4|74/76|a.6.1.7|1/1|Putative DNA-binding domain| OP:NHOMO 117 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22---212222222222-2222222222222222222222-----2222222222222222-2222222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,34-40,127-131| PSIPRED ccHHHHHccHHHHHHHHcccHHHHHHHHHHHcHHHccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccc //