[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68603.1
DDBJ      :             protein ElaB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:101 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   30->84 PF05957 * DUF883 1e-08 49.1 %
:HMM:PFM   9->101 PF05957 * DUF883 2.3e-33 48.4 93/94  
:BLT:SWISS 1->84 ELAB_ECOLI 3e-28 86.9 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68603.1 GT:GENE ACF68603.1 GT:PRODUCT protein ElaB GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2466340..2466645) GB:FROM 2466340 GB:TO 2466645 GB:DIRECTION - GB:PRODUCT protein ElaB GB:NOTE identified by match to protein family HMM PF05957 GB:PROTEIN_ID ACF68603.1 GB:DB_XREF GI:194408384 LENGTH 101 SQ:AASEQ MSYQFGESRVDDDLTLLSETLEEILRSSGDPADQKYIELKARAEQALEEVKNRVSHASDSYYYRAKQAVYKADDYVHEKPWQGIGVGAAVGLVLGLLLARR GT:EXON 1|1-101:0| BL:SWS:NREP 1 BL:SWS:REP 1->84|ELAB_ECOLI|3e-28|86.9|84/101| COIL:NAA 26 COIL:NSEG 1 COIL:REGION 34->59| TM:NTM 1 TM:REGION 78->99| SEG 11->28|dddltllsetleeilrss| SEG 85->99|gvgaavglvlgllla| RP:PFM:NREP 1 RP:PFM:REP 30->84|PF05957|1e-08|49.1|55/94|DUF883| HM:PFM:NREP 1 HM:PFM:REP 9->101|PF05957|2.3e-33|48.4|93/94|DUF883| OP:NHOMO 60 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---111111111111-1111111111111111111---11---111111111111111111111111--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcc //