[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68621.1
DDBJ      :             DNA protection during starvation protein
Swiss-Prot:DPS_SALTY    RecName: Full=DNA protection during starvation protein;         EC=1.16.-.-;

Homologs  Archaea  0/68 : Bacteria  321/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->167 1f33F PDBj 3e-85 95.0 %
:RPS:PDB   14->167 1dpsB PDBj 4e-20 95.5 %
:RPS:SCOP  9->167 1dpsA  a.25.1.1 * 3e-18 94.3 %
:HMM:SCOP  9->167 1dpsA_ a.25.1.1 * 6.2e-48 37.7 %
:RPS:PFM   30->164 PF00210 * Ferritin 5e-07 25.2 %
:HMM:PFM   31->166 PF00210 * Ferritin 2.6e-20 18.9 132/142  
:BLT:SWISS 1->167 DPS_SALTY 2e-92 100.0 %
:PROS 51->67|PS00818|DPS_1
:PROS 77->91|PS00819|DPS_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68621.1 GT:GENE ACF68621.1 GT:PRODUCT DNA protection during starvation protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(946922..947425) GB:FROM 946922 GB:TO 947425 GB:DIRECTION - GB:PRODUCT DNA protection during starvation protein GB:NOTE identified by match to protein family HMM PF00210 GB:PROTEIN_ID ACF68621.1 GB:DB_XREF GI:194408402 LENGTH 167 SQ:AASEQ MSTAKLVKTKASNLLYTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDEDTADIFTAASRDLDKFLWFIESNIE GT:EXON 1|1-167:0| SW:ID DPS_SALTY SW:DE RecName: Full=DNA protection during starvation protein; EC=1.16.-.-; SW:GN Name=dps; OrderedLocusNames=STM0831; SW:KW Complete proteome; Cytoplasm; DNA condensation; DNA-binding; Iron;Iron storage; Metal-binding; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->167|DPS_SALTY|2e-92|100.0|167/167| GO:SWS:NREP 7 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0030261|"GO:chromosome condensation"|DNA condensation| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006879|"GO:cellular iron ion homeostasis"|Iron storage| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 51->67|PS00818|DPS_1|PDOC00645| PROS 77->91|PS00819|DPS_2|PDOC00645| BL:PDB:NREP 1 BL:PDB:REP 9->167|1f33F|3e-85|95.0|159/159| RP:PDB:NREP 1 RP:PDB:REP 14->167|1dpsB|4e-20|95.5|154/154| RP:PFM:NREP 1 RP:PFM:REP 30->164|PF00210|5e-07|25.2|131/141|Ferritin| HM:PFM:NREP 1 HM:PFM:REP 31->166|PF00210|2.6e-20|18.9|132/142|Ferritin| GO:PFM:NREP 2 GO:PFM GO:0006879|"GO:cellular iron ion homeostasis"|PF00210|IPR008331| GO:PFM GO:0008199|"GO:ferric iron binding"|PF00210|IPR008331| RP:SCP:NREP 1 RP:SCP:REP 9->167|1dpsA|3e-18|94.3|159/159|a.25.1.1| HM:SCP:REP 9->167|1dpsA_|6.2e-48|37.7|159/0|a.25.1.1|1/1|Ferritin-like| OP:NHOMO 346 OP:NHOMOORG 322 OP:PATTERN -------------------------------------------------------------------- ------11111-1-221----2---2------22221121-111111-1211112111111--11112111-111111-----------------------1----1-----------------------------111-2-----2221--111-----------1222-------------111-----1--111111212111111--111-11--1-----1111111--------1--------11--2------1-1-1111----1--1111---111111111111111111111111111111111-111111---------------------------------------------------1-1------------12------1-11111111111-------11-----11--------------1-1----1-------------11-----------------------------------1--1-----1111-1----11-------1-1-------------11----1-----1-1--------------11-----------------------111121--------------------------------1-1-1-1---1--------1----1----1----------11-11111111111111-1111111111111111111111111-11111111111111111111111111-111111111111------------------1111-11--------------1-11--1111--111----1111--------------------------111111111-1------------------------------------------------------------ -----------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 95.2 SQ:SECSTR ########cTTTccccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHTcc DISOP:02AL 1-4,6-7| PSIPRED ccccHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcc //