[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68627.1
DDBJ      :             nickel-dependent hydrogenase, B-type cytochrome subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  146/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.21.1
:176 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->175 1kqfC_ f.21.1.1 * 6.7e-27 30.1 %
:RPS:PFM   20->77 PF02480 * Herpes_gE 6e-04 37.5 %
:HMM:PFM   3->174 PF00033 * Cytochrom_B_N 1.8e-27 28.7 164/188  
:BLT:SWISS 1->173 C56H_ECOLI 3e-54 56.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68627.1 GT:GENE ACF68627.1 GT:PRODUCT nickel-dependent hydrogenase, B-type cytochrome subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1342489..1343019) GB:FROM 1342489 GB:TO 1343019 GB:DIRECTION - GB:PRODUCT nickel-dependent hydrogenase, B-type cytochrome subunit GB:NOTE identified by match to protein family HMM PF01292 GB:PROTEIN_ID ACF68627.1 GB:DB_XREF GI:194408408 LENGTH 176 SQ:AASEQ MAHFSRLQITLHWLTLLLTGIAYAAIELRGWAPKGSGVYLFMKDTHYDMGVLVWALMFLRLYLKHKYPDPVITPPPPHWQHVAAKLMHIALYLTFLALPLLGVAMMASGGKSWSFFGFTVPVFLTPDSALKSDIKRIHEMLANIGYFLIAMHAAAALFHHYIQKDDTFSRMLPGKS GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 1->173|C56H_ECOLI|3e-54|56.1|173/176| TM:NTM 3 TM:REGION 11->32| TM:REGION 41->63| TM:REGION 84->106| SEG 7->19|lqitlhwltlllt| SEG 91->101|lyltflalpll| RP:PFM:NREP 1 RP:PFM:REP 20->77|PF02480|6e-04|37.5|56/411|Herpes_gE| HM:PFM:NREP 1 HM:PFM:REP 3->174|PF00033|1.8e-27|28.7|164/188|Cytochrom_B_N| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02480|IPR003404| HM:SCP:REP 1->175|1kqfC_|6.7e-27|30.1|166/0|f.21.1.1|1/1|Transmembrane di-heme cytochromes| OP:NHOMO 197 OP:NHOMOORG 146 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-2---------------------1------------------------------------------1-1----------------------------------------111111-111-11--1111-111-11121211--1---11-2--1------1-------------------------------------------------------------------------11---11--1---------------------------------111111-2221211122-22222122-121122222111111---212122222222221112111111--122222222222---------1111-2------------------------------11111122111121111------------------------11-----111-1-1----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,73-73,175-177| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //