[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68682.1
DDBJ      :             phosphatase YfbT
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  284/915 : Eukaryota  121/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:219 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->144 2qltA PDBj 2e-14 36.4 %
:BLT:PDB   126->204 1te2A PDBj 4e-05 26.6 %
:RPS:PDB   4->203 3d6jA PDBj 4e-24 19.0 %
:RPS:SCOP  2->203 2hszA1  c.108.1.6 * 2e-26 21.3 %
:HMM:SCOP  1->203 1vj5A1 c.108.1.2 * 1.7e-45 32.0 %
:HMM:PFM   4->175 PF00702 * Hydrolase 4.4e-27 26.9 171/192  
:BLT:SWISS 1->215 YFBT_ECOLI 4e-99 87.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68682.1 GT:GENE ACF68682.1 GT:PRODUCT phosphatase YfbT GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2490669..2491328) GB:FROM 2490669 GB:TO 2491328 GB:DIRECTION - GB:PRODUCT phosphatase YfbT GB:NOTE identified by match to protein family HMM PF00702; match to protein family HMM TIGR01509; match to protein family HMM TIGR01549 GB:PROTEIN_ID ACF68682.1 GB:DB_XREF GI:194408463 LENGTH 219 SQ:AASEQ MQCKGFLFDLDGTLVDSLPAVERAWCSWADRFNLAHDEVLGFIHGKQAITSLRHFMAGKSEAEIAAEFTRLEQIEATETAGITALPGAVDLLNHLNKAGIPWAIVTSGSMPVARARHQVAGLPAPEVFVTAERVKRGKPEPDAYLLGAQLLGLAPQECVVVEDAPAGVLSGLAAGCHVIAVNAPADTPRLADVDFALDSLTQLSVAKQPNGDVVVLRKT GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 1->215|YFBT_ECOLI|4e-99|87.0|215/216| SEG 145->156|llgaqllglapq| BL:PDB:NREP 2 BL:PDB:REP 7->144|2qltA|2e-14|36.4|132/251| BL:PDB:REP 126->204|1te2A|4e-05|26.6|79/211| RP:PDB:NREP 1 RP:PDB:REP 4->203|3d6jA|4e-24|19.0|200/206| HM:PFM:NREP 1 HM:PFM:REP 4->175|PF00702|4.4e-27|26.9|171/192|Hydrolase| RP:SCP:NREP 1 RP:SCP:REP 2->203|2hszA1|2e-26|21.3|202/224|c.108.1.6| HM:SCP:REP 1->203|1vj5A1|1.7e-45|32.0|200/226|c.108.1.2|1/1|HAD-like| OP:NHOMO 552 OP:NHOMOORG 409 OP:PATTERN --------------------------------------------------1-1--------11----- 121-1-1----11-----------11-----1-1111111-21-1-1121112123-1--22-12123331-----------------1111-211----1-------1----------------111-----1--1----111121--------111--1-----1---11--1--------4-111------------------------------------1----------------------------2-1--------11--11-----------------------------------------------------1--------1---1--------11-1---11-----1---------1------1--1-----1--33---1----11111111111-1-----11111-311-22122221-------111111--11111111111---1-----------------------------------------122121-----2211--1---211------1111-----1---1--1----1--------------------1-----------1----1-------1---------------------------1111-1-------------------------------------21113211222112211-211123312122211111211111--211111111111111111112111-2-111111111111-------------1-------------1----1----------2---1--111------211------------11-----11--111-11111111111----11--------------------------------------------------1-1 ---------------111-11112211111111111-211122111-111112211111111-23222115511134244222212---3331243333122121--1-------1--1--------11251--121------1------1--1--1-1--------1-1---1--1-1-2-111115411-1112112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 94.5 SQ:SECSTR ccccEEEEcccTTTEEcHHHHHHHHHHHHHHTTccccHHHHTTTTccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHGGGcEEcTTHHHHHHHHHHHTcEEEEEccccHHHHHHHHHTccTTcccEEEcGGGccccTTcTHHHHHHHHHTTccGGGEEEEEccHHHHHHHHHHTcEEEEETTcTTGGGGccccEEEccGGGGHHHH############ PSIPRED ccccEEEEcccccccccHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHccccccEEEEHHHcccccccHHHHHHHHHHccccHHHEEEEcccHHHHHHHHHcccEEEEEcccccHHHHccccEEEccHHHHHHHHcccccEEEEEEc //