[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68701.1
DDBJ      :             multidrug resistance protein MdtM
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  475/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:410 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   54->208 2gfpA PDBj 2e-07 25.8 %
:RPS:SCOP  58->327 1pv6A  f.38.1.2 * 2e-06 14.0 %
:HMM:SCOP  1->403 1pw4A_ f.38.1.1 * 1.1e-49 24.6 %
:RPS:PFM   22->356 PF07690 * MFS_1 9e-08 24.2 %
:HMM:PFM   27->361 PF07690 * MFS_1 2.2e-31 24.7 328/353  
:BLT:SWISS 1->406 MDFA_ECOLI 0.0 85.0 %
:PROS 72->88|PS00216|SUGAR_TRANSPORT_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68701.1 GT:GENE ACF68701.1 GT:PRODUCT multidrug resistance protein MdtM GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 985762..986994 GB:FROM 985762 GB:TO 986994 GB:DIRECTION + GB:PRODUCT multidrug resistance protein MdtM GB:NOTE identified by match to protein family HMM PF07690 GB:PROTEIN_ID ACF68701.1 GB:DB_XREF GI:194408482 LENGTH 410 SQ:AASEQ MQNRLQSGGRLGRQALLFPLCLVLYEFSTYIGNDMIQPGMLAVVEQYQAGLDWVPTSMTAYLAGGMFLQWLLGPLSDRIGRRPVMLAGVVWFIVTCLATLLAKNIEQFTFLRFLQGISLCFIGAVGYAAIQESFEEAVCIKITALMANVALIAPLLGPLVGAAWVHVLPWEGMFILFAALAAIAFFGLQRAMPETATRRGETLSFKALGRDYRLVIKNRRFVAGALALGFVSLPLLAWIAQSPIIIISGEQLSSYEYGLLQVPVFGALIAGNLVLARLTSRRTVRSLIVMGGWPIVAGLIIAAAATVVSSHAYLWMTAGLSVYAFGIGLANAGLVRLTLFSSDMSKGTVSAAMGMLQMLIFTVGIEVSKHAWLSGGNGLFSLFNLANGILWLLLMLVFLKDKRTGNLQTV GT:EXON 1|1-410:0| BL:SWS:NREP 1 BL:SWS:REP 1->406|MDFA_ECOLI|0.0|85.0|406/410| PROS 72->88|PS00216|SUGAR_TRANSPORT_1|PDOC00190| TM:NTM 11 TM:REGION 10->32| TM:REGION 71->93| TM:REGION 109->131| TM:REGION 140->162| TM:REGION 171->193| TM:REGION 228->249| TM:REGION 257->279| TM:REGION 285->307| TM:REGION 317->339| TM:REGION 346->368| TM:REGION 375->397| SEG 174->186|filfaalaaiaff| BL:PDB:NREP 1 BL:PDB:REP 54->208|2gfpA|2e-07|25.8|155/375| RP:PFM:NREP 1 RP:PFM:REP 22->356|PF07690|9e-08|24.2|330/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 27->361|PF07690|2.2e-31|24.7|328/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 58->327|1pv6A|2e-06|14.0|257/417|f.38.1.2| HM:SCP:REP 1->403|1pw4A_|1.1e-49|24.6|399/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 1093 OP:NHOMOORG 498 OP:PATTERN --------------------------------------------1-1-1--1---------------- ----21-1112--------------1-------121-122----122-111-1131--------1--1111-----------------22----------11--1213---------------------------111121-------------------------------------------1------1-2222222221222222--111-222---1---1111113212222222222222221121-------------------2-------------------------------------------------------------------11---------1----111----------------12111-1112--2231111111212222122223-11-11112322-42232322223323-11122111122122222222111211-111111111-----1----1------2122-11-11212132444442333233112222125231212--11221211311131131-21332----1-1---2-11211-11---1----11--1--2111-11---2--1-1111-1----------1-----232-1--1-112222243254431322324-------------73123554544444444-543554444455444444455546465555455555555554544343332-1433333333333--21212224444-1134111212-11-1111233333311111122122246243421111234445343144443334377644-1---------------------------------------------------------------------1- ------------------1-----21-------1----------------11-211--1---1-----1---1-1--------------1----1--------------------------------------------------------------------1-------------------------2----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 37.8 SQ:SECSTR #####################################################HHHHHHHHHHHHHHHHTTHHHHHTTcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccTTTccTHH########################################################################################################################################################################################################## DISOP:02AL 1-12,405-411| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //