[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68706.1
DDBJ      :             exonuclease
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  49/915 : Eukaryota  0/199 : Viruses  7/175   --->[See Alignment]
c.52.1
:226 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->226 1avqA PDBj e-117 85.0 %
:RPS:PDB   2->226 1avqC PDBj 9e-50 84.9 %
:RPS:SCOP  1->226 1avqA  c.52.1.13 * e-100 85.0 %
:HMM:SCOP  1->226 1avqA_ c.52.1.13 * 7.6e-66 32.7 %
:RPS:PFM   24->168 PF09588 * YqaJ 1e-09 41.5 %
:HMM:PFM   23->168 PF09588 * YqaJ 1.6e-30 34.3 140/150  
:HMM:PFM   174->215 PF10884 * DUF2683 0.00075 27.5 40/80  
:BLT:SWISS 1->226 EXO_LAMBD e-116 85.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68706.1 GT:GENE ACF68706.1 GT:PRODUCT exonuclease GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1105334..1106014) GB:FROM 1105334 GB:TO 1106014 GB:DIRECTION - GB:PRODUCT exonuclease GB:NOTE identified by match to protein family HMM PF09588 GB:PROTEIN_ID ACF68706.1 GB:DB_XREF GI:194408487 LENGTH 226 SQ:AASEQ MTPEIILARTGIDVSNIEQGDEAWHRLRLGVITASEVHNVISKPRSGKKWTDMKMSYFLTLLAEVCTGVAPEVNARALAWGKQYEDDARTLFEFTTDVKVTGSPILFRDEDMRTACSPDGLCSDGRGLELKCPFTSRDFMKFRLGGFEAIKSAYMAQVQFSMWVTGRDAWYFANYDPRMKREGIHHVVVERDDKYMSLFNEMVPEFIEKMDEALKEIGFTFGEQWR GT:EXON 1|1-226:0| BL:SWS:NREP 1 BL:SWS:REP 1->226|EXO_LAMBD|e-116|85.0|226/226| BL:PDB:NREP 1 BL:PDB:REP 1->226|1avqA|e-117|85.0|226/228| RP:PDB:NREP 1 RP:PDB:REP 2->226|1avqC|9e-50|84.9|225/225| RP:PFM:NREP 1 RP:PFM:REP 24->168|PF09588|1e-09|41.5|135/145|YqaJ| HM:PFM:NREP 2 HM:PFM:REP 23->168|PF09588|1.6e-30|34.3|140/150|YqaJ| HM:PFM:REP 174->215|PF10884|0.00075|27.5|40/80|DUF2683| RP:SCP:NREP 1 RP:SCP:REP 1->226|1avqA|e-100|85.0|226/228|c.52.1.13| HM:SCP:REP 1->226|1avqA_|7.6e-66|32.7|226/228|c.52.1.13|1/1|Restriction endonuclease-like| OP:NHOMO 78 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------14316------------------------------1-------------------1-------1---1-----------------------------------------------------1-1----1------------------1---------------------1-------1------------------------------------------------------------------------------------------------------------------------1--33111111--4121--2111312111-11------1-1-------1--1-1-----1----------------------------------------1------1-------------------------1------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------1-11----1--------111------------------ STR:NPRED 226 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHcccGGGccTTcHHHHHTTTTcEEGGGTHHHHccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccEEccccEEccTTccEEEcccEEETTccEEEEEccccHHHHHHHHHHGGGTccHHHHHHHHHHHHHHTccEEEEEEEcTTcccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHTccTTGGGc DISOP:02AL 1-2,7-7| PSIPRED ccHHHHHHcccccccccccccHHHHHHHHccccHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEccEEEcccccEEEEEccEEcccccEEEEEcccccHHHHHHHccccccccHHHHHHHHHHHHcccccEEEEEEEccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //