[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68719.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:66 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 3->63 KIL_ECOLI 4e-07 41.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68719.1 GT:GENE ACF68719.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1107189..1107389) GB:FROM 1107189 GB:TO 1107389 GB:DIRECTION - GB:PRODUCT conserved domain protein GB:PROTEIN_ID ACF68719.1 GB:DB_XREF GI:194408500 LENGTH 66 SQ:AASEQ MTNYGTTTLPRTSVVPGMLVKYQGRTYRASANVGKGLYLFTLFERLRTTNDEIEVYLNQHGKPATH GT:EXON 1|1-66:0| BL:SWS:NREP 1 BL:SWS:REP 3->63|KIL_ECOLI|4e-07|41.0|61/100| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1--1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,62-67| PSIPRED ccccccccccccccccccEEEEccEEEEEEcccccEEEEEEEHHHccccHHHHHHEEccccccccc //