[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68741.1
DDBJ      :             electron transport complex protein RnfE
Swiss-Prot:RNFE_SALTY   RecName: Full=Electron transport complex protein rnfE;

Homologs  Archaea  2/68 : Bacteria  285/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:230 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->155 PF02508 * Rnf-Nqr 8e-22 40.3 %
:HMM:PFM   1->200 PF02508 * Rnf-Nqr 2.5e-62 45.9 181/190  
:BLT:SWISS 1->230 RNFE_SALTY e-109 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68741.1 GT:GENE ACF68741.1 GT:PRODUCT electron transport complex protein RnfE GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1576311..1577003) GB:FROM 1576311 GB:TO 1577003 GB:DIRECTION - GB:PRODUCT electron transport complex protein RnfE GB:NOTE identified by match to protein family HMM PF02508; match to protein family HMM TIGR01948 GB:PROTEIN_ID ACF68741.1 GB:DB_XREF GI:194408522 LENGTH 230 SQ:AASEQ MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV GT:EXON 1|1-230:0| SW:ID RNFE_SALTY SW:DE RecName: Full=Electron transport complex protein rnfE; SW:GN Name=rnfE; OrderedLocusNames=STM1454; SW:KW Cell inner membrane; Cell membrane; Complete proteome;Electron transport; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->230|RNFE_SALTY|e-109|100.0|230/230| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 6 TM:REGION 6->28| TM:REGION 38->59| TM:REGION 69->91| TM:REGION 96->118| TM:REGION 127->149| TM:REGION 183->205| SEG 32->59|tstatnalglglattlvltltnltvsal| RP:PFM:NREP 1 RP:PFM:REP 2->155|PF02508|8e-22|40.3|154/187|Rnf-Nqr| HM:PFM:NREP 1 HM:PFM:REP 1->200|PF02508|2.5e-62|45.9|181/190|Rnf-Nqr| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02508|IPR003667| OP:NHOMO 449 OP:NHOMOORG 287 OP:PATTERN -------------------------------------------------11----------------- --------------------------------------------------------------------------------1-------2222-222----1--11-----111111111111111---1-211-12----------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------21-11111111-1--211111-11112211--------13--11---1---1------------------------------------------------------------------1111-11-------------1------------------------------------1---------------------------------------------------41-1--211111111--332-13221111-311---------1--------1---------------------------223222222223433323333333333333--2113111-11111111111111111111-1111111111111111111222112221111111111111111211111111-222222222222---2---------42212222222222222232-------111433333----3----4------------122222222222222--------------1111--------------1-1-------------------------2122212111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,208-231| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHEEEEEEEccccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc //