[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68763.1
DDBJ      :             polysaccharide deacetylase domain protein
Swiss-Prot:ARND_SALHS   RecName: Full=Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase arnD;         EC=3.5.1.n3;

Homologs  Archaea  0/68 : Bacteria  136/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   43->254 2c1gA PDBj 5e-13 12.8 %
:RPS:SCOP  15->260 1z7aA1  c.6.2.6 * 2e-12 18.8 %
:HMM:SCOP  2->285 2c71A1 c.6.2.3 * 5e-23 28.4 %
:HMM:PFM   15->161 PF01522 * Polysacc_deac_1 1.9e-12 27.3 99/124  
:BLT:SWISS 1->299 ARND_SALHS e-170 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68763.1 GT:GENE ACF68763.1 GT:PRODUCT polysaccharide deacetylase domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2455634..2456533 GB:FROM 2455634 GB:TO 2456533 GB:DIRECTION + GB:PRODUCT polysaccharide deacetylase domain protein GB:NOTE identified by match to protein family HMM PF01522 GB:PROTEIN_ID ACF68763.1 GB:DB_XREF GI:194408544 LENGTH 299 SQ:AASEQ MTKVGLRIDVDTLRGTREGVPRLLATLHRHGVQASFFFSVGPDNMGRHLWRLIRPRFLWKMLRSNAASLYGWDILLAGTAWPGKNIGNANAGIIRETATYHETGLHAWDHHAWQTHSGHWSIRQLEEDIARGITALEAIIGKPVTCSAAAGWRADGRVVRAKEPFNLRYNSDCRGTTLFRPLLMPDQTGTPQIPVTLPTWDEVIGPAVQAQSFNTWIISRMLQDKGTPVYTIHAEVEGIVHQPLFEDLLVRARDAGITFCPLGELLPTSPESLPLGQIVRGHIPGREGWLGCQQAASAS GT:EXON 1|1-299:0| SW:ID ARND_SALHS SW:DE RecName: Full=Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase arnD; EC=3.5.1.n3; SW:GN Name=arnD; OrderedLocusNames=SeHA_C2540; SW:KW Antibiotic resistance; Complete proteome; Hydrolase;Lipid A biosynthesis; Lipid synthesis;Lipopolysaccharide biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->299|ARND_SALHS|e-170|100.0|299/299| GO:SWS:NREP 5 GO:SWS GO:0046677|"GO:response to antibiotic"|Antibiotic resistance| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0009245|"GO:lipid A biosynthetic process"|Lipid A biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0009103|"GO:lipopolysaccharide biosynthetic process"|Lipopolysaccharide biosynthesis| SEG 261->276|plgellptspeslplg| RP:PDB:NREP 1 RP:PDB:REP 43->254|2c1gA|5e-13|12.8|196/384| HM:PFM:NREP 1 HM:PFM:REP 15->161|PF01522|1.9e-12|27.3|99/124|Polysacc_deac_1| RP:SCP:NREP 1 RP:SCP:REP 15->260|1z7aA1|2e-12|18.8|197/301|c.6.2.6| HM:SCP:REP 2->285|2c71A1|5e-23|28.4|201/0|c.6.2.3|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 137 OP:NHOMOORG 136 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-------------2----11----------------------------11-1111-------------------------------------11--------------------------1----------------111111111111111-11111111111111111111111111111111111111111111111111111111111111111--1------------------------------------------1111-111-------11-----------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 249 STR:RPRED 83.3 SQ:SECSTR ###EGccEEEEE##cccTTHHHHHHHHHHTTcccEEEEcHHHcEEEEEEEccccTTTHHHHHHHHHHTTcccEEHHcEEEEcGGGTTTcHHHHHHHHHTTcEEEEcccccccGGGccTGccHHHHHHHHHHHHHHHHHHHcccccEEccGGGcccHHHHHHcccEEEcccEEccHHHHccHHHHHHHHHHHHccTTHEEEEEETTcHHHHHHHHHHHEcHHHHHTTcEEccHEHHHHGGGccTTTcEEcHcccc############################################# DISOP:02AL 1-1,296-300| PSIPRED ccEEEEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHcHHHHHHHHHcccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccEEEEEEcccccHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccEEEcHHHHHHHHHccccccccccccccEEEEEccccccEEEEccccccHHHHccccccHHHHHHHHHHHHHcccccEEEEEcHHHccHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHccccEEEEEcccccccEEEEEcccccc //