[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68776.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y8K6_BPP22   RecName: Full=Uncharacterized 8.6 kDa protein in ral-gp17 intergenic region;AltName: Full=ORF78;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->78 Y8K6_BPP22 1e-32 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68776.1 GT:GENE ACF68776.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(383946..384182) GB:FROM 383946 GB:TO 384182 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF68776.1 GB:DB_XREF GI:194408557 LENGTH 78 SQ:AASEQ MKDIPHWDVDEDYIVDVTEGHILFSAENANKQEIKLASAAPELLEALLSIIDMEHDVSEWDAVYATARAAIGKALGKE GT:EXON 1|1-78:0| SW:ID Y8K6_BPP22 SW:DE RecName: Full=Uncharacterized 8.6 kDa protein in ral-gp17 intergenic region;AltName: Full=ORF78; SW:GN SW:KW SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->78|Y8K6_BPP22|1e-32|100.0|78/100| SEG 36->49|lasaapellealls| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,77-79| PSIPRED ccccccccccccEEEEEEccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccc //