[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68780.1
DDBJ      :             putative colanic acid biosynthesis acetyltransferase WcaB
Swiss-Prot:WCAB_SHIFL   RecName: Full=Putative colanic acid biosynthesis acetyltransferase wcaB;         EC=2.3.1.-;

Homologs  Archaea  16/68 : Bacteria  588/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->142 3gvdK PDBj 7e-17 41.7 %
:RPS:PDB   40->142 3eg4A PDBj 1e-12 7.8 %
:RPS:SCOP  2->142 1s80A  b.81.1.6 * 5e-20 31.9 %
:HMM:SCOP  1->142 1t3dA_ b.81.1.6 * 7.1e-26 31.7 %
:HMM:PFM   111->125 PF00132 * Hexapep 0.00014 46.7 15/18  
:BLT:SWISS 1->144 WCAB_SHIFL 7e-76 90.3 %
:PROS 101->129|PS00101|HEXAPEP_TRANSFERASES
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68780.1 GT:GENE ACF68780.1 GT:PRODUCT putative colanic acid biosynthesis acetyltransferase WcaB GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2245069..2245509) GB:FROM 2245069 GB:TO 2245509 GB:DIRECTION - GB:PRODUCT putative colanic acid biosynthesis acetyltransferase WcaB GB:NOTE identified by match to protein family HMM PF00132 GB:PROTEIN_ID ACF68780.1 GB:DB_XREF GI:194408561 LENGTH 146 SQ:AASEQ MVLAYRIAHFCSVWRKKNVLNNLWAAPVLVLYRVITECLFGYEIQAAATIGRRFTIHHGYAVVINKHVVAGDDFTIRHGVTIGNRGADSLACPVIGNGVELGANVILLGDITIGNHVTIGAGSVVLDSIPDHALVVGEKARVKVST GT:EXON 1|1-146:0| SW:ID WCAB_SHIFL SW:DE RecName: Full=Putative colanic acid biosynthesis acetyltransferase wcaB; EC=2.3.1.-; SW:GN Name=wcaB; OrderedLocusNames=SF2122, S2246; SW:KW Acyltransferase; Complete proteome; Lipopolysaccharide biosynthesis;Repeat; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->144|WCAB_SHIFL|7e-76|90.3|144/162| GO:SWS:NREP 3 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0009103|"GO:lipopolysaccharide biosynthetic process"|Lipopolysaccharide biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 101->129|PS00101|HEXAPEP_TRANSFERASES|PDOC00094| TM:NTM 2 TM:REGION 19->41| TM:REGION 88->110| BL:PDB:NREP 1 BL:PDB:REP 4->142|3gvdK|7e-17|41.7|127/260| RP:PDB:NREP 1 RP:PDB:REP 40->142|3eg4A|1e-12|7.8|103/279| HM:PFM:NREP 1 HM:PFM:REP 111->125|PF00132|0.00014|46.7|15/18|Hexapep| RP:SCP:NREP 1 RP:SCP:REP 2->142|1s80A|5e-20|31.9|138/241|b.81.1.6| HM:SCP:REP 1->142|1t3dA_|7.1e-26|31.7|142/262|b.81.1.6|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 854 OP:NHOMOORG 626 OP:PATTERN ------------------------111111-111--------1-1-11--111--------------- 1111-111111111-11-----11-------------111-2311-111211111111-----1--1---------------------121--------1-12----1-1----------------1133111311111--1111-3232332-111-1--11111232311---111-1111-----11--11111111111111111111111111111111111111111111111111111111111121--------1-11---1----21-----------------------------------------21---2111121111111112111111111111-11-11111111111111111-----1111-----11-2311-1211111111111111-111112111-1-211122122211131111122222211--------12211121-----------------------------11-1-1-----211112111111122222222222111--1111111111111112211111121111111----221-1-----------111111211111-111---1111111111-1111111111111221122111121111111111111111121211--111111-11122121212332222221-3222222223322222222111212113222222232222222123222221-1111111111111111---------314--11111111111111211111111112222112112-33323-111--------111212222211111--------------11--111111------------------------------------1111--1-----1 -1------11---------------------------------------------------------------------------------------------------1------------------------------------------------------------3----2112R3332-1315-43-1----5 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 99.3 SQ:SECSTR #HHHEEEccccccccccccTTcccEEcTTEEEEEEEEccTccccEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTccEEETTTccEEccEEcTTEEEEEEEEEccccTTcccccEEEEEEEEEEccHHHHHHccHHHHcccc DISOP:02AL 146-147| PSIPRED cEEEEEcccEEEEHHHHHHHHHHHcccEEEEEEEEcEEEEEEEEccccEEccccEEccccEEEEcccEEEccccEEccccEEcccccccccccEEccccEEccccEEEccEEEccccEEccccEEEEEEccccEEEEcccEEEEcc //