[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68789.1
DDBJ      :             peptidyl-tRNA hydrolase domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  351/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
d.50.4
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->140 2jy9A PDBj 1e-73 100.0 %
:RPS:PDB   1->140 2b3tB PDBj 4e-21 24.6 %
:RPS:SCOP  3->103 1j26A  d.50.4.1 * 1e-23 23.8 %
:RPS:PFM   8->129 PF00472 * RF-1 1e-09 50.5 %
:HMM:PFM   3->132 PF00472 * RF-1 9.7e-32 47.1 104/114  
:BLT:SWISS 1->136 YAEJ_ECOLI 2e-61 85.3 %
:PROS 21->37|PS00745|RF_PROK_I

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68789.1 GT:GENE ACF68789.1 GT:PRODUCT peptidyl-tRNA hydrolase domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 288967..289389 GB:FROM 288967 GB:TO 289389 GB:DIRECTION + GB:PRODUCT peptidyl-tRNA hydrolase domain protein GB:NOTE identified by match to protein family HMM PF00472 GB:PROTEIN_ID ACF68789.1 GB:DB_XREF GI:194408570 LENGTH 140 SQ:AASEQ MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRASGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKSRRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLD GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 1->136|YAEJ_ECOLI|2e-61|85.3|136/140| PROS 21->37|PS00745|RF_PROK_I|PDOC00607| BL:PDB:NREP 1 BL:PDB:REP 1->140|2jy9A|1e-73|100.0|140/148| RP:PDB:NREP 1 RP:PDB:REP 1->140|2b3tB|4e-21|24.6|114/300| RP:PFM:NREP 1 RP:PFM:REP 8->129|PF00472|1e-09|50.5|97/107|RF-1| HM:PFM:NREP 1 HM:PFM:REP 3->132|PF00472|9.7e-32|47.1|104/114|RF-1| GO:PFM:NREP 2 GO:PFM GO:0003747|"GO:translation release factor activity"|PF00472|IPR000352| GO:PFM GO:0006415|"GO:translational termination"|PF00472|IPR000352| RP:SCP:NREP 1 RP:SCP:REP 3->103|1j26A|1e-23|23.8|101/112|d.50.4.1| OP:NHOMO 371 OP:NHOMOORG 370 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------1-1---------1--11------------------------------1---1-111-1---------------11111111111----------1----------1-111--1--111-1111111111-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111-----111111111111111111111111-11111111111-11111111111111111111111111111111111-111-111------------------------------111-11121-1111111111111111111111111111--11-1111111111111111111----------1--11111111---1-----1-----------1--1------------------------1--111111111111111111111111111111---11-1------11--1111111111111-1111111111111111111111-----11111111111111111111111---111111111111---111111----11111----------------------1111111111111111111111---------11111-----111--1111111111--------------------------------------------------------------- ----11--------------------------------------------------------------------------1-------------1------------------1-----------------------------------------------------111----1-11--1111----1---111---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 100.0 SQ:SECSTR cccTTTccccccccEEEEEcccccccTTTcccccEEEEEEETcTTccccHHHHHHHHHcccTTcccTTccEEEEEEcccHHHHHHHHHHHHHHHHTTTTTTccccccccEEEEEETTTTEEEEGGGTEETTEccHHHHHH DISOP:02AL 98-141| PSIPRED ccccccccEEcHHHEEEEEEEccccccccccccccEEEEEEcHHHHcccHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccc //